CATH Domain: 3csvA02 XML data for domain: 3csvA02

Molscript image for 3csvA02
3csvA02
PDB coordinates for domain 3csvA02

PDB 3csv, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.90 Alpha-Beta Complex
3.90.1200 Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2
3.90.1200.10 Gene3D
3.90.1200.10.2
3.90.1200.10.2.1
3.90.1200.10.2.1.1
3.90.1200.10.2.1.1.1
3.90.1200.10.2.1.1.1.1

[top]
Segment boundaries for domain 3csvA02

Chopping figure for domain 3csvA02
DomainStart PDB ResidueStop PDB Residue
3csvA01 3 92
3csvA02 93 332

Structural Neighbourhood (0 entries)

Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.


[top]
Domain ATOM Sequence 

>pdb|3csvA02
LGDALFTEVINNDPAQEPLYRAAVDLLIHLHDAQTPELARLDPETLSETRLAFSEYRYAILGDAAEDNRKRFEHRFAQIL
SAQLEGDVFVHRDFHAQNLLWLPEREGLARVGVIDFQDAKLGHRAYDLVSLLQDARRDVPAQVEAQIDHYIQATGVDESH
FRSAYAVIAVQRNRILGIFARLSQRFGKRHYIEFVPRVWAHFERGLAHPALASAAEEILNALPAPAPEVLERLRA
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|3csvA02
LGDALFTEVINNDPAQEXPLYRAAVDLLIHLHDAQTPELARLDPETLSEXTRLAFSEYRYAILGDAAEDNRKRFEHRFAQ
ILSAQLEGDXVFVHRDFHAQNLLWLPEREGLARVGVIDFQDAKLGHRAYDLVSLLQDARRDVPAQVEAQXIDHYIQATGV
DESHFRSAYAVIAVQRNXRILGIFARLSQRFGKRHYIEFVPRVWAHFERGLAHPALASAAEEILNALPAPAPEVLERLRA
BLAST against CATH

[top]
Domain History Events (82)

Domain assigned by cuff on 12 Mar 2009 17:51

same superfamily

Domain assignment manual match h by cuff on 12 Mar 2009 17:49

homology match

Homcheck allotment by cuff on 12 Mar 2009 17:47

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by cuff on 12 Mar 2009 17:47

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 12 Mar 2009 15:02

Domain "3csvA02" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 12 Mar 2009 15:02

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 3csvA02

Flow stage update by auto on 12 Mar 2009 14:58

Retrieved PRC_PFAMCATH results for job ID SID9563070336100056 and results inserted.

Domain scan prc pfamcath by auto on 12 Mar 2009 14:57

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 630 results for 3csvA02

Update comment by auto on 12 Mar 2009 10:18

PRC_PFAMCATH job SID9563070336100056 is not yet finished.

Flow stage update by auto on 12 Mar 2009 10:08

The entry "3csvA02" has been submitted to the PRC_PFAMCATH webservice.

Prc pfamcath submit by auto on 12 Mar 2009 10:08

The entry "3csvA02" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 12 Mar 2009 09:11

Retrieved SSAP results for job ID SID3342388483621568 and results inserted.

Domain scan ssap cath by auto on 12 Mar 2009 09:10

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 205 results for 3csvA02

Update comment by auto on 09 Mar 2009 22:05

SSAP job SID3342388483621568 is not yet finished.

Ssap cath submit by auto on 09 Mar 2009 21:49

The entry "3csvA02" has been submitted to the SSAP webservice.

Flow stage update by auto on 09 Mar 2009 21:49

The entry "3csvA02" has been submitted to the SSAP webservice.

Flow stage update by auto on 09 Mar 2009 20:39

Retrieved PRC results for job ID SID9027325918441232 and inserted them into the database.

Domain scan prc cath by auto on 09 Mar 2009 20:38

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 57 results for 3csvA02

Update comment by auto on 09 Mar 2009 12:42

PRC job SID9027325918441232 is not yet finished.

Prc cath submit by auto on 09 Mar 2009 12:16

The entry "3csvA02" has been submitted to the PRC webservice.

Flow stage update by auto on 09 Mar 2009 12:16

The entry "3csvA02" has been submitted to the PRC webservice.

Flow stage update by auto on 09 Mar 2009 11:04

Retrieved HMM(SAM) results for job ID SID5638588962625021 and inserted them into the database.

Domain scan sam cath by auto on 09 Mar 2009 11:04

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 8 results for 3csvA02

Update comment by auto on 04 Mar 2009 12:46

HMM(SAM) job SID5638588962625021 is not yet finished.

Flow stage update by auto on 04 Mar 2009 12:18

The entry "3csvA02" has been submitted to the HMM (SAM) webservice.

Sam cath submit by auto on 04 Mar 2009 12:18

The entry "3csvA02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 04 Mar 2009 05:53

Unable to retrieve "3csvA02" HMM(SAM) results for job "SID0467776900739669"

Update comment by auto on 04 Mar 2009 01:26

HMM(SAM) job SID0467776900739669 is not yet finished.

Flow stage update by auto on 04 Mar 2009 00:03

The entry "3csvA02" has been submitted to the HMM (SAM) webservice.

Sam cath submit by auto on 04 Mar 2009 00:03

The entry "3csvA02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 19 Feb 2009 16:18

Unable to retrieve "3csvA02" HMM(SAM) results for job "SID2906191034752838"

Sam cath submit by auto on 19 Feb 2009 15:29

The entry "3csvA02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 19 Feb 2009 15:29

The entry "3csvA02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 19 Feb 2009 13:59

Retrieved "3csvA02" CATHEDRAL results for job ID SID3019435860409472 and inserted them into the database.

Domain scan cathedral cath by auto on 19 Feb 2009 13:57

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 614 results for 3csvA02

Update comment by auto on 19 Feb 2009 07:46

"3csvA02" CATHEDRAL job SID3019435860409472 is not yet finished.

Cathedral cath submit by auto on 19 Feb 2009 06:31

The entry "3csvA02" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 19 Feb 2009 06:31

The entry "3csvA02" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 27 Jan 2009 12:07

Unable to retrieve "3csvA02" CATHEDRAL results for job "SID9401602702715982"

Update comment by auto on 22 Jan 2009 17:15

"3csvA02" CATHEDRAL job SID9401602702715982 is not yet finished.

Flow stage update by auto on 22 Jan 2009 16:52

The entry "3csvA02" has been submitted to the CATHEDRAL webservice.

Cathedral cath submit by auto on 22 Jan 2009 16:52

The entry "3csvA02" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 21 Dec 2008 15:14

ScanList with 12830 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/3csvA02.scanlist" for "3csvA02"

Write scan list by auto on 21 Dec 2008 15:14

Writing ScanList containing 12830 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/3csvA02.scanlist" for domain "3csvA02"

Update comment by auto on 21 Dec 2008 11:52

Waiting for 76 new domains (example : 3davB00) to be processed so that they can be scanned against too.

Update comment by auto on 20 Dec 2008 20:42

Waiting for 113 new domains (example : 3bmkB00) to be processed so that they can be scanned against too.

Update comment by auto on 20 Dec 2008 19:04

Waiting for 148 new domains (example : 3bllA00) to be processed so that they can be scanned against too.

Update comment by auto on 20 Dec 2008 14:36

Waiting for 197 new domains (example : 2vmtA02) to be processed so that they can be scanned against too.

Update comment by auto on 20 Dec 2008 11:36

Waiting for 239 new domains (example : 2jknF00) to be processed so that they can be scanned against too.

Update comment by auto on 20 Dec 2008 07:50

Waiting for 256 new domains (example : 2jkjA00) to be processed so that they can be scanned against too.

Update comment by auto on 20 Dec 2008 03:59

Waiting for 248 new domains (example : 2jkjA00) to be processed so that they can be scanned against too.

Update comment by auto on 20 Dec 2008 00:50

Waiting for 246 new domains (example : 2jkjA00) to be processed so that they can be scanned against too.

Update comment by auto on 19 Dec 2008 20:43

Waiting for 197 new domains (example : 2jkjA00) to be processed so that they can be scanned against too.

Update comment by auto on 19 Dec 2008 16:56

Waiting for 189 new domains (example : 2jkjA00) to be processed so that they can be scanned against too.

Update comment by auto on 19 Dec 2008 11:35

Waiting for 32 new domains (example : 2jknA00) to be processed so that they can be scanned against too.

Update comment by auto on 17 Dec 2008 23:34

Waiting for 2 new domains (example : 3fcxA00) to be processed so that they can be scanned against too.

Update comment by auto on 17 Dec 2008 22:12

Waiting for 27 new domains (example : 3ex7B00) to be processed so that they can be scanned against too.

Update comment by auto on 17 Dec 2008 17:38

Waiting for 80 new domains (example : 2zecD01) to be processed so that they can be scanned against too.

Update comment by auto on 17 Dec 2008 14:52

Waiting for 132 new domains (example : 2zebD01) to be processed so that they can be scanned against too.

Update comment by auto on 17 Dec 2008 11:32

Waiting for 174 new domains (example : 2zebD01) to be processed so that they can be scanned against too.

Update comment by auto on 17 Dec 2008 09:48

Waiting for 227 new domains (example : 2w42B01) to be processed so that they can be scanned against too.

Update comment by auto on 17 Dec 2008 04:25

Waiting for 270 new domains (example : 2rklB00) to be processed so that they can be scanned against too.

Update comment by auto on 17 Dec 2008 00:28

Waiting for 285 new domains (example : 2jldA01) to be processed so that they can be scanned against too.

Update comment by auto on 16 Dec 2008 20:36

Waiting for 267 new domains (example : 2jldA01) to be processed so that they can be scanned against too.

Update comment by auto on 16 Dec 2008 18:32

Waiting for 261 new domains (example : 2jldA01) to be processed so that they can be scanned against too.

Update comment by auto on 16 Dec 2008 14:43

Waiting for 215 new domains (example : 2jldA01) to be processed so that they can be scanned against too.

Update comment by auto on 16 Dec 2008 10:55

Waiting for 201 new domains (example : 2jldA01) to be processed so that they can be scanned against too.

Update comment by auto on 15 Dec 2008 20:40

Waiting for 150 new domains (example : 2jldA01) to be processed so that they can be scanned against too.

Update comment by auto on 15 Dec 2008 17:14

Waiting for 297 new domains (example : 2r6gG01) to be processed so that they can be scanned against too.

Update comment by auto on 14 Dec 2008 20:42

Waiting for 337 new domains (example : 2r6gG01) to be processed so that they can be scanned against too.

Update comment by auto on 14 Dec 2008 17:19

Waiting for 547 new domains (example : 2r6gG01) to be processed so that they can be scanned against too.

Update comment by auto on 13 Dec 2008 20:38

Waiting for 598 new domains (example : 2r6gG01) to be processed so that they can be scanned against too.

Update comment by auto on 13 Dec 2008 16:51

Waiting for 852 new domains (example : 2r6gG01) to be processed so that they can be scanned against too.

Update comment by auto on 12 Dec 2008 20:56

Waiting for 902 new domains (example : 2r6gG01) to be processed so that they can be scanned against too.

Update comment by auto on 12 Dec 2008 17:05

Waiting for 1430 new domains (example : 2nrfA00) to be processed so that they can be scanned against too.

Update comment by auto on 10 Dec 2008 14:48

Waiting for 1534 new domains (example : 2gqgA02) to be processed so that they can be scanned against too.

Flow stage update by auto on 10 Dec 2008 14:42

No satisfactory AssignClose result found.

Flow stage update by auto on 10 Dec 2008 14:17

No in_process hits for Domain "3csvA02" ready to be processed

Flow stage update by auto on 10 Dec 2008 14:17

NW result present for Domain "3csvA02"

Flow stage update by auto on 05 Dec 2008 08:14

All required files are present for Domain "3csvA02"

Flow stage update by auto on 04 Dec 2008 17:23

Beginning processing for Domain "3csvA02"

Insertion by cuff on 04 Dec 2008 11:51

nice chopping