CATH Domain: 3cinA02 XML data for domain: 3cinA02

Molscript image for 3cinA02
3cinA02
PDB coordinates for domain 3cinA02

PDB 3cin, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.360 Dihydrodipicolinate Reductase; domain 2
3.30.360.10 Dihydrodipicolinate Reductase; domain 2 Gene3D
3.30.360.10.18
3.30.360.10.18.1
3.30.360.10.18.1.1
3.30.360.10.18.1.1.1
3.30.360.10.18.1.1.1.1

[top]
Segment boundaries for domain 3cinA02

Chopping figure for domain 3cinA02
DomainStart PDB ResidueStop PDB Residue
3cinA01 0 211
3cinA01 316 381
3cinA02 212 315

Structural Neighbourhood (3 entries)

There are 3 matching structural neighberhood comparisons for CATH ID 3.30.360.10.18.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 3 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1u1iA02 88.08 Archaeoglobus fulgidusMyo-inositol-1-phosphate synthase (Ino1)Streptomycin biosynthesisMyo-inositol-1-phosphate synthase [EC:5.5.1.4]Inositol phosphate metabolism 3.30.360.10 101 22 97 2.50 2.58
1gr0A02 86.69 Streptomycin biosynthesisMetabolic pathwaysInositol phosphate metabolismUncharacterized protein Rv0046c/MT0052Myo-inositol-1-phosphate synthase [EC:5.5.1.4] 3.30.360.10 84 25 77 1.60 2.06
1jkfA03 79.32 Identical protein bindingInositol-3-phosphate synthaseMetabolic pathwaysMyo-inositol-1-phosphate synthase [EC:5.5.1.4]Cytoplasm 3.30.360.10 60 16 54 1.43 2.63
[1]
Displaying entries 1 to 3 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|3cinA02
GATPFTADVLSHLAQRNRYVKDVAQFNIGGNMDFLALTDDGKNKSKEFTKSSIVKDILGYDAPHYIKPTGYLEPLGDKKF
IAIHIEYVSFNGATDELMINGRIN
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|3cinA02
GATPFTADVLSHLAQRNRYVKDVAQFNIGGNMDFLALTDDGKNKSKEFTKSSIVKDILGYDAPHYIKPTGYLEPLGDKKF
IAIHIEYVSFNGATDELMINGRIN
BLAST against CATH

[top]
Domain History Events (6)

Domain assigned by auto on 29 Mar 2008 23:16

Assigning to "3.30.360.10" based on similarity with "1vjpA02"

Flow stage update by auto on 29 Mar 2008 23:05

No in_process hits for Domain "3cinA02" ready to be processed

Flow stage update by auto on 29 Mar 2008 23:04

NW result present for Domain "3cinA02"

Flow stage update by auto on 29 Mar 2008 11:05

All required files are present for Domain "3cinA02"

Flow stage update by auto on 28 Mar 2008 15:05

Beginning processing for Domain "3cinA02"

Insertion by auto on 28 Mar 2008 14:07

Final ChopClose added based on similarity with "1vjpA"