CATH Domain: 2a2rA02 XML data for domain: 2a2rA02

Molscript image for 2a2rA02
2a2rA02
PDB coordinates for domain 2a2rA02

PDB 2a2r, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.20 Up-down Bundle
1.20.1050 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2
1.20.1050.10 Gene3D
1.20.1050.10.3
1.20.1050.10.3.1
1.20.1050.10.3.1.1
1.20.1050.10.3.1.1.1
1.20.1050.10.3.1.1.1.1

[top]
Segment boundaries for domain 2a2rA02

Chopping figure for domain 2a2rA02
DomainStart PDB ResidueStop PDB Residue
2a2rA01 0 78
2a2rA01 187 208
2a2rA02 79 186

Structural Neighbourhood (26 entries)

There are 26 matching structural neighberhood comparisons for CATH ID 1.20.1050.10.3.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 26 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1dugA02 91.74 Fibrinogen gamma chainGlutathione S-transferase class-mu 26 kDa isozymeExternal side of plasma membraneFibrinogen complexEukaryotic cell surface binding 1.20.1050.10 105 33 96 1.64 1.70
2c4jA02 91.72 Glutathione S-transferase [EC:2.5.1.18]Drug metabolism - cytochrome P450Metabolism of xenobiotics by cytochrome P450Glutathione S-transferase Mu 2Homo sapiens 1.20.1050.10 105 31 96 1.28 1.33
3fr3B02 91.28 Glutathione S-transferase [EC:2.5.1.18]Metabolism of xenobiotics by cytochrome P450Glutathione S-transferaseGlutathione metabolismPlasmodium falciparum 1.20.1050.10 114 25 89 1.28 1.43
2cvdA02 89.74 CytoplasmProstaglandin-H2 D-isomerase [EC:5.3.99.2]Arachidonic acid metabolismProstaglandin-D synthase activityHematopoietic prostaglandin D synthase 1.20.1050.10 108 18 92 1.66 1.79
2gsqA02 89.26 Ommastrephes sloaniGlutathione S-transferase 1.20.1050.10 108 24 97 2.10 2.16
2dsaA02 88.63 Glutathione S-transferase [EC:2.5.1.18]Metabolism of xenobiotics by cytochrome P450Glutathione S-transferaseGlutathione metabolismBurkholderia xenovorans LB400 1.20.1050.10 106 20 95 2.26 2.37
3h1nA02 88.49 Bordetella bronchisepticaProbable glutathione S-transferase 1.20.1050.10 115 16 86 1.71 1.97
1m0uA02 88.21 Glutathione S-transferase [EC:2.5.1.18]Drug metabolism - cytochrome P450Glutathione S-transferase S1Metabolism of xenobiotics by cytochrome P450Glutathione peroxidase activity 1.20.1050.10 112 19 92 2.23 2.40
1oe8A02 87.17 Schistosoma haematobiumGlutathione S-transferase class-mu 28 kDa isozyme 1.20.1050.10 124 21 85 1.93 2.26
1eemA02 86.15 Glutathione S-transferase [EC:2.5.1.18]Drug metabolism - cytochrome P450Glutathione S-transferase omega-1Metabolism of xenobiotics by cytochrome P450Homo sapiens 1.20.1050.10 115 18 92 2.47 2.68
3f6dB02 85.99 Anopheles dirusGlutathione transferase GST1-4 1.20.1050.10 123 19 78 1.93 2.47
2cz2A02 85.13 Tyrosine metabolismGlutathione transferase activityGlutathione metabolismMetabolic pathwaysGlutathione S-transferase [EC:2.5.1.18] 1.20.1050.10 122 20 83 1.99 2.38
1e6bA02 85.12 Arabidopsis thalianaToxin catabolic processGlutathione S-transferase zeta-class 1 1.20.1050.10 111 13 83 3.38 4.03
2pvqA02 84.95 Glutathione S-transferaseOchrobactrum anthropi 1.20.1050.10 104 19 88 4.14 4.66
1hqoA02 84.82 Soluble fractionCytosolProtein URE2Cytoplasmic sequestering of transcription factorProtein urmylation 1.20.1050.10 126 12 83 2.61 3.13
1n2aA02 84.59 Metabolism of xenobiotics by cytochrome P450Glutathione metabolismGlutathione S-transferase [EC:2.5.1.18]Glutathione S-transferaseEscherichia coli K-12 1.20.1050.10 106 14 93 2.68 2.87
1v2aA02 84.42 Anopheles dirusGlutathione transferase gst1-6 1.20.1050.10 132 20 78 2.41 3.09
2v6kA02 84.09 Maleylpyruvate isomeraseRalstonia sp. U2 1.20.1050.10 130 15 81 2.45 3.00
1gnwA02 83.64 Glutathione bindingMicrosomeChloroplast stromaPlasma membraneToxin catabolic process 1.20.1050.10 125 11 81 2.67 3.27
1aw9A02 83.30 Glutathione transferase III(A)Zea mays 1.20.1050.10 121 21 84 2.94 3.49
1gwcA02 82.50 Aegilops tauschiiGlutathione S-transferase 1 1.20.1050.10 141 23 76 2.43 3.17
1nhyA02 82.22 Positive regulation of transcription from RNA polymerase II promoterCalcium ion bindingNucleusElongation factor 1-gamma 1Transcription coactivator activity 1.20.1050.10 139 15 74 2.77 3.70
3cbuA02 80.48 Glutathione S-transferase [EC:2.5.1.18]Ralstonia eutropha JMP134Metabolism of xenobiotics by cytochrome P450Probable gst-related proteinGlutathione metabolism 1.20.1050.10 132 20 77 2.88 3.73
1k0oB02 80.09 Membrane fractionChloride intracellular channel protein 1Soluble fractionChloride transportSignal transduction 1.20.1050.10 123 24 75 3.10 4.10
2vo4A02 79.86 2,4-D inducible glutathione S-transferaseGlycine max 1.20.1050.10 132 19 76 2.87 3.75
2c3nA02 77.54 Soluble fractionGlutathione S-transferase theta-1Glutathione metabolic processGlutathione transferase activityGlutathione metabolism 1.20.1050.10 160 20 65 3.23 4.92
[1]
Displaying entries 1 to 26 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2a2rA02
YGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDL
LLIHEVLAPGCLDAFPLLSAYVGRLSAR
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2a2rA02
YGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDL
LLIHEVLAPGCLDAFPLLSAYVGRLSAR
BLAST against CATH

[top]
Domain History Events (19)

Domain assigned by auto on 03 Nov 2006 02:21

Assigning to "1.20.1050.10" based on similarity with "9gssB02"

Flow stage update by auto on 03 Nov 2006 02:17

No in_process hits for Domain "2a2rA02" ready to be processed

Update comment by auto on 02 Nov 2006 22:11

Domain "2a2rA02" hits Domain "2a2sA02" (100% over 100%) which is currently in process

Update comment by auto on 02 Nov 2006 18:14

Domain "2a2rA02" hits Domain "2a2sB02" (100% over 100%) which is currently in process

Update comment by auto on 02 Nov 2006 14:25

Domain "2a2rA02" hits Domain "2a2rB02" (100% over 100%) which is currently in process

Update comment by auto on 02 Nov 2006 10:06

Domain "2a2rA02" hits Domain "1tu7A02" (45.3703703703704% over 99.0825688073395%) which is currently in process

Update comment by auto on 02 Nov 2006 06:12

Domain "2a2rA02" hits Domain "1tu8D02" (45.3703703703704% over 99.0825688073395%) which is currently in process

Update comment by auto on 02 Nov 2006 03:17

Domain "2a2rA02" hits Domain "1tu8B02" (45.3703703703704% over 99.0825688073395%) which is currently in process

Update comment by auto on 01 Nov 2006 21:56

Domain "2a2rA02" hits Domain "1tu8A02" (45.3703703703704% over 99.0825688073395%) which is currently in process

Update comment by auto on 01 Nov 2006 18:04

Domain "2a2rA02" hits Domain "1tu8C02" (45.3703703703704% over 99.0825688073395%) which is currently in process

Update comment by auto on 01 Nov 2006 14:27

Domain "2a2rA02" hits Domain "1tu7B02" (45.3703703703704% over 99.0825688073395%) which is currently in process

Update comment by auto on 01 Nov 2006 09:48

Domain "2a2rA02" hits Domain "1tu7B02" (45.3703703703704% over 99.0825688073395%) which is currently in process

Update comment by auto on 01 Nov 2006 05:50

Domain "2a2rA02" hits Domain "1tu7B02" (45.3703703703704% over 99.0825688073395%) which is currently in process

Update comment by auto on 01 Nov 2006 02:09

Domain "2a2rA02" hits Domain "1tu7B02" (45.3703703703704% over 99.0825688073395%) which is currently in process

Flow stage update by auto on 31 Oct 2006 09:49

Domain "2a2rA02" hits Domain "1tu7B02" (45.3703703703704% over 99.0825688073395%) which is currently in process

Flow stage update by auto on 31 Oct 2006 09:48

NW result present for Domain "2a2rA02"

Flow stage update by auto on 28 Oct 2006 01:49

All required files are present for Domain "2a2rA02"

Flow stage update by auto on 27 Oct 2006 05:42

Beginning processing for Domain "2a2rA02"

Insertion by auto on 27 Oct 2006 05:19

Final ChopClose added based on similarity with "11gsA"