Set cath from cathlist by auto on 05 Mar 2006 18:02
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1pdnC01 | 2 | 69 |
| 1pdnC02 | 70 | 124 |
There are 17 matching structural neighberhood comparisons for CATH ID 1.10.10.10.117.1.2.1.1 (SIMAX score < 5)
>pdb|1pdnC01 QGRVNQLGGVFINGRPLPNNIRLKIVEMAADGIRPCVISRQLRVSHGCVSKILNRYQETGSIRPGVIG
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"