Set cath from cathlist by auto on 05 Mar 2006 19:36
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1bs0A01 | 25 | 56 |
| 1bs0A01 | 285 | 384 |
| 1bs0A02 | 57 | 284 |
There are 27 matching structural neighberhood comparisons for CATH ID 3.90.1150.10.6.1.1.1.1 (SIMAX score < 5)
>pdb|1bs0A01 PVAQGAGRWLVADDRQYLNFSSNDYLGLSHHPSDEGDARREKLAALITRFRAGVQDLPFTLADSCSAIQPLIVGDNSRAL QLAEKLRQQGCWVTAIRPPTVPAGTARLRLTLTAAHEMQDIDRLLEVLHGNG
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"