PDB: 3cro XML data for PDB: 3cro

Molscript image for 3cro
3cro
PDB coordinates for PDB 3cro

PDB 3cro

CATH Domains (2)

Domain IDChain IDCATH codeImage
3croL00 3croL 1.10.260.40 Molscript image for 3croL00
3croR00 3croR 1.10.260.40 Molscript image for 3croR00

Chain: 3croA

Sorry the PDB chain 3croA has been rejected from CATH as it does not pass the SIFT criteria.


Chain: 3croB

Sorry the PDB chain 3croB has been rejected from CATH as it does not pass the SIFT criteria.


Chain: 3croL

Chopping figure for chain 3croL

Chain: 3croR

Chopping figure for chain 3croR

Chain: 3croA

Sorry, we couldn't get FASTA sequence information for '3croA'. Either the entity '3croA' does not exist in this version of CATH or it does not pass the SIFT criteria for entry in the database.

Chain: 3croB

Sorry, we couldn't get FASTA sequence information for '3croB'. Either the entity '3croB' does not exist in this version of CATH or it does not pass the SIFT criteria for entry in the database.

Chain: 3croL

>pdb|3croL
MQTLSERLKKRRIALKMTQTELATKAGVKQQSIQLIEAGVTKRPRFLFEIAMALNCDPVWLQYGTKRGKAA    

Chain: 3croR

>pdb|3croR
MQTLSERLKKRRIALKMTQTELATKAGVKQQSIQLIEAGVTKRPRFLFEIAMALNCDPVWLQYGTKRGKAA