PDB: 2hdc XML data for PDB: 2hdc

Molscript image for 2hdc
2hdc
PDB coordinates for PDB 2hdc

PDB 2hdc

CATH Domains (1)

Domain IDChain IDCATH codeImage
2hdcA00 2hdcA 1.10.10.10 Molscript image for 2hdcA00

[top]
Chain: 2hdcA

Chopping figure for chain 2hdcA

[top]
Chain: 2hdcB

Sorry the PDB chain 2hdcB has been rejected from CATH as it does not pass the SIFT criteria.


[top]
Chain: 2hdcC

Sorry the PDB chain 2hdcC has been rejected from CATH as it does not pass the SIFT criteria.


[top]
Chain: 2hdcA 

>pdb|2hdcA
VKPPYSYIALITMAILQSPQKKLTLSGICEFISNRFPYYREKFPAWQNSIRHNLSLNDCFVKIPREPGNPGKGNYWTLDP
QSEDMFDNGSFLRRRKR
BLAST against CATH

[top]
Chain: 2hdcB

Sorry, we couldn't get FASTA sequence information for '2hdcB'. Either the entity '2hdcB' does not exist in this version of CATH or it does not pass the SIFT criteria for entry in the database.

[top]
Chain: 2hdcC

Sorry, we couldn't get FASTA sequence information for '2hdcC'. Either the entity '2hdcC' does not exist in this version of CATH or it does not pass the SIFT criteria for entry in the database.