PDB: 2bop XML data for PDB: 2bop

Molscript image for 2bop
2bop
PDB coordinates for PDB 2bop

PDB 2bop

CATH Domains (1)

Domain IDChain IDCATH codeImage
2bopA00 2bopA 3.30.70.330 Molscript image for 2bopA00

[top]
Chain: 2bopA

Chopping figure for chain 2bopA

[top]
Chain: 2bopB

Sorry the PDB chain 2bopB has been rejected from CATH as it does not pass the SIFT criteria.


[top]
Chain: 2bopA 

>pdb|2bopA
SCFALISGTANQVKCYRFRVKKNHRHRYENCTTTWFTVADNGAERQGQAQILITFGSPSQRQDFLKHVPLPPGMNISGFT
ASLDF
BLAST against CATH

[top]
Chain: 2bopB

Sorry, we couldn't get FASTA sequence information for '2bopB'. Either the entity '2bopB' does not exist in this version of CATH or it does not pass the SIFT criteria for entry in the database.