PDB: 1yui XML data for PDB: 1yui

Molscript image for 1yui
1yui
PDB coordinates for PDB 1yui

PDB 1yui

CATH Domains (1)

Domain IDChain IDCATH codeImage
1yuiA00 1yuiA 3.30.160.60 Molscript image for 1yuiA00

Chain: 1yuiA

Chopping figure for chain 1yuiA

Chain: 1yuiB

Sorry the PDB chain 1yuiB has been rejected from CATH as it does not pass the SIFT criteria.


Chain: 1yuiC

Sorry the PDB chain 1yuiC has been rejected from CATH as it does not pass the SIFT criteria.


Chain: 1yuiA

>pdb|1yuiA
PKAKRAKHPPGTEKPRSRSQSEQPATCPICYAVIRQSRNLRRHLELRHFAKPGV    

Chain: 1yuiB

Sorry, we couldn't get FASTA sequence information for '1yuiB'. Either the entity '1yuiB' does not exist in this version of CATH or it does not pass the SIFT criteria for entry in the database.

Chain: 1yuiC

Sorry, we couldn't get FASTA sequence information for '1yuiC'. Either the entity '1yuiC' does not exist in this version of CATH or it does not pass the SIFT criteria for entry in the database.