PDB: 1ysa XML data for PDB: 1ysa

Molscript image for 1ysa
1ysa
PDB coordinates for PDB 1ysa

PDB 1ysa

CATH Domains (2)

Domain IDChain IDCATH codeImage
1ysaC00 1ysaC 3.30.160.60 Molscript image for 1ysaC00
1ysaD00 1ysaD 3.30.160.60 Molscript image for 1ysaD00

Chain: 1ysaA

Sorry the PDB chain 1ysaA has been rejected from CATH as it does not pass the SIFT criteria.


Chain: 1ysaB

Sorry the PDB chain 1ysaB has been rejected from CATH as it does not pass the SIFT criteria.


Chain: 1ysaC

Chopping figure for chain 1ysaC

Chain: 1ysaD

Chopping figure for chain 1ysaD

Chain: 1ysaA

Sorry, we couldn't get FASTA sequence information for '1ysaA'. Either the entity '1ysaA' does not exist in this version of CATH or it does not pass the SIFT criteria for entry in the database.

Chain: 1ysaB

Sorry, we couldn't get FASTA sequence information for '1ysaB'. Either the entity '1ysaB' does not exist in this version of CATH or it does not pass the SIFT criteria for entry in the database.

Chain: 1ysaC

>pdb|1ysaC
MKDPAALKRARNTEAARRSRARKLQRMKQLEDKVEELLSKNYHLENEVARLKKLVGER    

Chain: 1ysaD

>pdb|1ysaD
MKDPAALKRARNTEAARRSRARKLQRMKQLEDKVEELLSKNYHLENEVARLKKLVGER