PDB: 1yrn XML data for PDB: 1yrn

Molscript image for 1yrn
1yrn
PDB coordinates for PDB 1yrn

PDB 1yrn

CATH Domains (2)

Domain IDChain IDCATH codeImage
1yrnA00 1yrnA 1.10.10.60 Molscript image for 1yrnA00
1yrnB00 1yrnB 1.10.10.60 Molscript image for 1yrnB00

[top]
Chain: 1yrnA

Chopping figure for chain 1yrnA

[top]
Chain: 1yrnB

Chopping figure for chain 1yrnB

[top]
Chain: 1yrnC

Sorry the PDB chain 1yrnC has been rejected from CATH as it does not pass the SIFT criteria.


[top]
Chain: 1yrnD

Sorry the PDB chain 1yrnD has been rejected from CATH as it does not pass the SIFT criteria.


[top]
Chain: 1yrnA 

>pdb|1yrnA
KKEKSPKGKSSISPQARAFLEQVFRRKQSLNSKEKEEVAKKCGITPLQVRVWFINKRMRSK
BLAST against CATH

[top]
Chain: 1yrnB 

>pdb|1yrnB
TKPYRGHRFTKENVRILESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRKEKTITIAPELADLLSGEPLAK
KKE
BLAST against CATH

[top]
Chain: 1yrnC

Sorry, we couldn't get FASTA sequence information for '1yrnC'. Either the entity '1yrnC' does not exist in this version of CATH or it does not pass the SIFT criteria for entry in the database.

[top]
Chain: 1yrnD

Sorry, we couldn't get FASTA sequence information for '1yrnD'. Either the entity '1yrnD' does not exist in this version of CATH or it does not pass the SIFT criteria for entry in the database.