PDB: 1ubd XML data for PDB: 1ubd

Molscript image for 1ubd
1ubd
PDB coordinates for PDB 1ubd

PDB 1ubd

CATH Domains (4)

Domain IDChain IDCATH codeImage
1ubdC01 1ubdC 3.30.160.60 Molscript image for 1ubdC01
1ubdC02 1ubdC 3.30.160.60 Molscript image for 1ubdC02
1ubdC03 1ubdC 3.30.160.60 Molscript image for 1ubdC03
1ubdC04 1ubdC 3.30.160.60 Molscript image for 1ubdC04

[top]
Chain: 1ubdA

Sorry the PDB chain 1ubdA has been rejected from CATH as it does not pass the SIFT criteria.


[top]
Chain: 1ubdB

Sorry the PDB chain 1ubdB has been rejected from CATH as it does not pass the SIFT criteria.


[top]
Chain: 1ubdC

Chopping figure for chain 1ubdC

[top]
Chain: 1ubdA

Sorry, we couldn't get FASTA sequence information for '1ubdA'. Either the entity '1ubdA' does not exist in this version of CATH or it does not pass the SIFT criteria for entry in the database.

[top]
Chain: 1ubdB

Sorry, we couldn't get FASTA sequence information for '1ubdB'. Either the entity '1ubdB' does not exist in this version of CATH or it does not pass the SIFT criteria for entry in the database.

[top]
Chain: 1ubdC 

>pdb|1ubdC
MEPRTIACPHKGCTKMFRDNSAMRKHLHTHGPRVHVCAECGKAFVESSKLKRHQLVHTGEKPFQCTFEGCGKRFSLDFNL
RTHVRIHTGDRPYVCPFDGCNKKFAQSTNLKSHILTHAKAKNNQ
BLAST against CATH