PDB: 1tf3 XML data for PDB: 1tf3

Molscript image for 1tf3
1tf3
PDB coordinates for PDB 1tf3

PDB 1tf3

CATH Domains (3)

Domain IDChain IDCATH codeImage
1tf3A01 1tf3A 3.30.160.60 Molscript image for 1tf3A01
1tf3A02 1tf3A 3.30.160.60 Molscript image for 1tf3A02
1tf3A03 1tf3A 3.30.160.60 Molscript image for 1tf3A03

[top]
Chain: 1tf3A

Chopping figure for chain 1tf3A

[top]
Chain: 1tf3E

Sorry the PDB chain 1tf3E has been rejected from CATH as it does not pass the SIFT criteria.


[top]
Chain: 1tf3F

Sorry the PDB chain 1tf3F has been rejected from CATH as it does not pass the SIFT criteria.


[top]
Chain: 1tf3A 

>pdb|1tf3A
MKRYICSFADCGAAYNKNWKLQAHLSKHTGEKPFPCKEEGCEKGFTSLHHLTRHSLTHTGEKNFTCDSDGCDLRFTTKAN
MKKHFNRFHNIK
BLAST against CATH

[top]
Chain: 1tf3E

Sorry, we couldn't get FASTA sequence information for '1tf3E'. Either the entity '1tf3E' does not exist in this version of CATH or it does not pass the SIFT criteria for entry in the database.

[top]
Chain: 1tf3F

Sorry, we couldn't get FASTA sequence information for '1tf3F'. Either the entity '1tf3F' does not exist in this version of CATH or it does not pass the SIFT criteria for entry in the database.