PDB: 1tc3 XML data for PDB: 1tc3

Molscript image for 1tc3
1tc3
PDB coordinates for PDB 1tc3

PDB 1tc3

CATH Domains (1)

Domain IDChain IDCATH codeImage
1tc3C00 1tc3C 1.10.10.60 Molscript image for 1tc3C00

Chain: 1tc3A

Sorry the PDB chain 1tc3A has been rejected from CATH as it does not pass the SIFT criteria.


Chain: 1tc3B

Sorry the PDB chain 1tc3B has been rejected from CATH as it does not pass the SIFT criteria.


Chain: 1tc3C

Chopping figure for chain 1tc3C

Chain: 1tc3A

Sorry, we couldn't get FASTA sequence information for '1tc3A'. Either the entity '1tc3A' does not exist in this version of CATH or it does not pass the SIFT criteria for entry in the database.

Chain: 1tc3B

Sorry, we couldn't get FASTA sequence information for '1tc3B'. Either the entity '1tc3B' does not exist in this version of CATH or it does not pass the SIFT criteria for entry in the database.

Chain: 1tc3C

>pdb|1tc3C
PRGSALSDTERAQLDVMKLLNVSLHEMSRKISRSRHCIRVYLKDPVSYGTS