PDB: 1srs XML data for PDB: 1srs

Molscript image for 1srs
1srs
PDB coordinates for PDB 1srs

PDB 1srs

CATH Domains (2)

Domain IDChain IDCATH codeImage
1srsA01 1srsA Not yet assigned Molscript image for 1srsA01
1srsB01 1srsB Not yet assigned Molscript image for 1srsB01

[top]
Chain: 1srsA

Chopping figure for chain 1srsA

[top]
Chain: 1srsB

Chopping figure for chain 1srsB

[top]
Chain: 1srsC

Sorry the PDB chain 1srsC has been rejected from CATH as it does not pass the SIFT criteria.


[top]
Chain: 1srsW

Sorry the PDB chain 1srsW has been rejected from CATH as it does not pass the SIFT criteria.


[top]
Chain: 1srsA 

>pdb|1srsA
SGAKPGKKTRGRVKIKMEFIDNKLRRYTTFSKRKTGIMKKAYELSTLTGTQVLLLVASETGHVYTFATRKLQPMITSETG
KALIQTCLNSPD
BLAST against CATH

[top]
Chain: 1srsB 

>pdb|1srsB
SGAKPGKKTRGRVKIKMEFIDNKLRRYTTFSKRKTGIMKKAYELSTLTGTQVLLLVASETGHVYTFATRKLQPMITSETG
KALIQTCLNSPD
BLAST against CATH

[top]
Chain: 1srsC

Sorry, we couldn't get FASTA sequence information for '1srsC'. Either the entity '1srsC' does not exist in this version of CATH or it does not pass the SIFT criteria for entry in the database.

[top]
Chain: 1srsW

Sorry, we couldn't get FASTA sequence information for '1srsW'. Either the entity '1srsW' does not exist in this version of CATH or it does not pass the SIFT criteria for entry in the database.