PDB: 1rep XML data for PDB: 1rep

Molscript image for 1rep
1rep
PDB coordinates for PDB 1rep

PDB 1rep

CATH Domains (2)

Domain IDChain IDCATH codeImage
1repC01 1repC 1.10.10.10 Molscript image for 1repC01
1repC02 1repC 1.10.10.10 Molscript image for 1repC02

[top]
Chain: 1repA

Sorry the PDB chain 1repA has been rejected from CATH as it does not pass the SIFT criteria.


[top]
Chain: 1repB

Sorry the PDB chain 1repB has been rejected from CATH as it does not pass the SIFT criteria.


[top]
Chain: 1repC

Chopping figure for chain 1repC

[top]
Chain: 1repA

Sorry, we couldn't get FASTA sequence information for '1repA'. Either the entity '1repA' does not exist in this version of CATH or it does not pass the SIFT criteria for entry in the database.

[top]
Chain: 1repB

Sorry, we couldn't get FASTA sequence information for '1repB'. Either the entity '1repB' does not exist in this version of CATH or it does not pass the SIFT criteria for entry in the database.

[top]
Chain: 1repC 

>pdb|1repC
MAETAVINHKKRKNSPRIVQSNDLTEAAYSLSRDQKRMLYLFVDQIRKSDGTLQEHDGICEIHVAKYAEIFGLTSAEASK
DIRQALKSFAGKEVVFYRPEEDAGDEKGYESFPWFIKPAHSPSRGLYSVHINPYLIPFFIGLQNRFTQFRLSETKEITNP
YAMRLYESLCQYRKPDGSGIVSLKIDWIIERYQLPQSYQRMPDFRRRFLQVCVNEINSRTPMRLSYIEKKKGRQTTHIVF
SFRDITSMTTG
BLAST against CATH