PDB: 1pyi XML data for PDB: 1pyi

Molscript image for 1pyi
1pyi
PDB coordinates for PDB 1pyi

PDB 1pyi

CATH Domains (2)

Domain IDChain IDCATH codeImage
1pyiA01 1pyiA Not yet assigned Molscript image for 1pyiA01
1pyiB00 1pyiB Not yet assigned Molscript image for 1pyiB00

[top]
Chain: 1pyiA

Chopping figure for chain 1pyiA

[top]
Chain: 1pyiB

Chopping figure for chain 1pyiB

[top]
Chain: 1pyiD

Sorry the PDB chain 1pyiD has been rejected from CATH as it does not pass the SIFT criteria.


[top]
Chain: 1pyiE

Sorry the PDB chain 1pyiE has been rejected from CATH as it does not pass the SIFT criteria.


[top]
Chain: 1pyiA 

>pdb|1pyiA
MKSRTACKRCRLKKIKCDQEFPSCKRCAKLEVPCVSLDPATGKDVPRSYVFFLEDRLAVMMRVLKEYGVDPTKIRGNIPA
TSDDEPFDLKKYSSVS
BLAST against CATH

[top]
Chain: 1pyiB 

>pdb|1pyiB
MKSRTACKRCRLKKIKCDQEFPSCKRCAKLEVPCVSLDPATGKDVPRSYVFFLEDRLAVMMRVLKEYGVDPT
BLAST against CATH

[top]
Chain: 1pyiD

Sorry, we couldn't get FASTA sequence information for '1pyiD'. Either the entity '1pyiD' does not exist in this version of CATH or it does not pass the SIFT criteria for entry in the database.

[top]
Chain: 1pyiE

Sorry, we couldn't get FASTA sequence information for '1pyiE'. Either the entity '1pyiE' does not exist in this version of CATH or it does not pass the SIFT criteria for entry in the database.