PDB: 1pue XML data for PDB: 1pue

Molscript image for 1pue
1pue
PDB coordinates for PDB 1pue

PDB 1pue

CATH Domains (2)

Domain IDChain IDCATH codeImage
1pueE00 1pueE 1.10.10.10 Molscript image for 1pueE00
1pueF00 1pueF 1.10.10.10 Molscript image for 1pueF00

[top]
Chain: 1pueA

Sorry the PDB chain 1pueA has been rejected from CATH as it does not pass the SIFT criteria.


[top]
Chain: 1pueB

Sorry the PDB chain 1pueB has been rejected from CATH as it does not pass the SIFT criteria.


[top]
Chain: 1pueC

Sorry the PDB chain 1pueC has been rejected from CATH as it does not pass the SIFT criteria.


[top]
Chain: 1pueD

Sorry the PDB chain 1pueD has been rejected from CATH as it does not pass the SIFT criteria.


[top]
Chain: 1pueE

Chopping figure for chain 1pueE

[top]
Chain: 1pueF

Chopping figure for chain 1pueF

[top]
Chain: 1pueA

Sorry, we couldn't get FASTA sequence information for '1pueA'. Either the entity '1pueA' does not exist in this version of CATH or it does not pass the SIFT criteria for entry in the database.

[top]
Chain: 1pueB

Sorry, we couldn't get FASTA sequence information for '1pueB'. Either the entity '1pueB' does not exist in this version of CATH or it does not pass the SIFT criteria for entry in the database.

[top]
Chain: 1pueC

Sorry, we couldn't get FASTA sequence information for '1pueC'. Either the entity '1pueC' does not exist in this version of CATH or it does not pass the SIFT criteria for entry in the database.

[top]
Chain: 1pueD

Sorry, we couldn't get FASTA sequence information for '1pueD'. Either the entity '1pueD' does not exist in this version of CATH or it does not pass the SIFT criteria for entry in the database.

[top]
Chain: 1pueE 

>pdb|1pueE
KIRLYQFLLDLLRSGDMKDSIWWVDKDKGTFQFSSKHKEALAHRWGIQKGNRKKMTYEKMARALRNYGKTGEVKKVKKKL
TYQFSGEVL
BLAST against CATH

[top]
Chain: 1pueF 

>pdb|1pueF
KIRLYQFLLDLLRSGDMKDSIWWVDKDKGTFQFSSKHKEALAHRWGIQKGNRKKMTYEKMARALRNYGKTGEVKKVKKKL
TYQFSGEVL
BLAST against CATH