PDB: 1per XML data for PDB: 1per

Molscript image for 1per
1per
PDB coordinates for PDB 1per

PDB 1per

CATH Domains (2)

Domain IDChain IDCATH codeImage
1perL00 1perL 1.10.260.40 Molscript image for 1perL00
1perR00 1perR 1.10.260.40 Molscript image for 1perR00

Chain: 1perA

Sorry the PDB chain 1perA has been rejected from CATH as it does not pass the SIFT criteria.


Chain: 1perB

Sorry the PDB chain 1perB has been rejected from CATH as it does not pass the SIFT criteria.


Chain: 1perL

Chopping figure for chain 1perL

Chain: 1perR

Chopping figure for chain 1perR

Chain: 1perA

Sorry, we couldn't get FASTA sequence information for '1perA'. Either the entity '1perA' does not exist in this version of CATH or it does not pass the SIFT criteria for entry in the database.

Chain: 1perB

Sorry, we couldn't get FASTA sequence information for '1perB'. Either the entity '1perB' does not exist in this version of CATH or it does not pass the SIFT criteria for entry in the database.

Chain: 1perL

>pdb|1perL
SISSRVKSKRIQLGLNQAELAQKVGTTQQSIEQLENGKTKRPRFLPELASALGVSVDWLLNGTSDSNVR    

Chain: 1perR

>pdb|1perR
SISSRVKSKRIQLGLNQAELAQKVGTTQQSIEQLENGKTKRPRFLPELASALGVSVDWLLNGTSDSNVR