PDB: 1pdn XML data for PDB: 1pdn

Molscript image for 1pdn
1pdn
PDB coordinates for PDB 1pdn

PDB 1pdn

CATH Domains (2)

Domain IDChain IDCATH codeImage
1pdnC01 1pdnC 1.10.10.10 Molscript image for 1pdnC01
1pdnC02 1pdnC 1.10.10.10 Molscript image for 1pdnC02

[top]
Chain: 1pdnA

Sorry the PDB chain 1pdnA has been rejected from CATH as it does not pass the SIFT criteria.


[top]
Chain: 1pdnB

Sorry the PDB chain 1pdnB has been rejected from CATH as it does not pass the SIFT criteria.


[top]
Chain: 1pdnC

Chopping figure for chain 1pdnC

[top]
Chain: 1pdnA

Sorry, we couldn't get FASTA sequence information for '1pdnA'. Either the entity '1pdnA' does not exist in this version of CATH or it does not pass the SIFT criteria for entry in the database.

[top]
Chain: 1pdnB

Sorry, we couldn't get FASTA sequence information for '1pdnB'. Either the entity '1pdnB' does not exist in this version of CATH or it does not pass the SIFT criteria for entry in the database.

[top]
Chain: 1pdnC 

>pdb|1pdnC
GQGRVNQLGGVFINGRPLPNNIRLKIVEMAADGIRPCVISRQLRVSHGCVSKILNRYQETGSIRPGVIGGSKPRIATPEI
ENRIEEYKRSSPGMFSWEIREKLIREGVCDRSTAPSVSAISRLVRGRD
BLAST against CATH