PDB: 1par XML data for PDB: 1par

Molscript image for 1par
1par
PDB coordinates for PDB 1par

PDB 1par

CATH Domains (4)

Domain IDChain IDCATH codeImage
1parA00 1parA 1.10.1220.10 Molscript image for 1parA00
1parB00 1parB 1.10.1220.10 Molscript image for 1parB00
1parC00 1parC 1.10.1220.10 Molscript image for 1parC00
1parD00 1parD 1.10.1220.10 Molscript image for 1parD00

[top]
Chain: 1parA

Chopping figure for chain 1parA

[top]
Chain: 1parB

Chopping figure for chain 1parB

[top]
Chain: 1parC

Chopping figure for chain 1parC

[top]
Chain: 1parD

Chopping figure for chain 1parD

[top]
Chain: 1parE

Sorry the PDB chain 1parE has been rejected from CATH as it does not pass the SIFT criteria.


[top]
Chain: 1parF

Sorry the PDB chain 1parF has been rejected from CATH as it does not pass the SIFT criteria.


[top]
Chain: 1parA 

>pdb|1parA
MKGMSKMPQFNLRWPREVLDLVRKVAEENGRSVNSEIYQRVMESFKKEGRIGA
BLAST against CATH

[top]
Chain: 1parB 

>pdb|1parB
MKGMSKMPQFNLRWPREVLDLVRKVAEENGRSVNSEIYQRVMESFKKEGRIGA
BLAST against CATH

[top]
Chain: 1parC 

>pdb|1parC
MKGMSKMPQFNLRWPREVLDLVRKVAEENGRSVNSEIYQRVMESFKKEGRIGA
BLAST against CATH

[top]
Chain: 1parD 

>pdb|1parD
MKGMSKMPQFNLRWPREVLDLVRKVAEENGRSVNSEIYQRVMESFKKEGRIGA
BLAST against CATH

[top]
Chain: 1parE

Sorry, we couldn't get FASTA sequence information for '1parE'. Either the entity '1parE' does not exist in this version of CATH or it does not pass the SIFT criteria for entry in the database.

[top]
Chain: 1parF

Sorry, we couldn't get FASTA sequence information for '1parF'. Either the entity '1parF' does not exist in this version of CATH or it does not pass the SIFT criteria for entry in the database.