PDB: 1oct XML data for PDB: 1oct

Molscript image for 1oct
1oct
PDB coordinates for PDB 1oct

PDB 1oct

CATH Domains (2)

Domain IDChain IDCATH codeImage
1octC01 1octC 1.10.260.40 Molscript image for 1octC01
1octC02 1octC 1.10.10.60 Molscript image for 1octC02

[top]
Chain: 1octA

Sorry the PDB chain 1octA has been rejected from CATH as it does not pass the SIFT criteria.


[top]
Chain: 1octB

Sorry the PDB chain 1octB has been rejected from CATH as it does not pass the SIFT criteria.


[top]
Chain: 1octC

Chopping figure for chain 1octC

[top]
Chain: 1octA

Sorry, we couldn't get FASTA sequence information for '1octA'. Either the entity '1octA' does not exist in this version of CATH or it does not pass the SIFT criteria for entry in the database.

[top]
Chain: 1octB

Sorry, we couldn't get FASTA sequence information for '1octB'. Either the entity '1octB' does not exist in this version of CATH or it does not pass the SIFT criteria for entry in the database.

[top]
Chain: 1octC 

>pdb|1octC
DLEELEQFAKTFKQRRIKLGFTQGDVGLAMGKLYGNDFSQTTISRFEALNLSFKNMCKLKPLLEKWLNDAENLSSDSSLS
SPSALNSPGIEGLSRRRKKRTSIETNIRVALEKSFLENQKPTSEEITMIADQLNMEKEVIRVWFCNRRQKEKRINP
BLAST against CATH