PDB: 1mse XML data for PDB: 1mse

Molscript image for 1mse
1mse
PDB coordinates for PDB 1mse

PDB 1mse

CATH Domains (2)

Domain IDChain IDCATH codeImage
1mseC01 1mseC 1.10.10.60 Molscript image for 1mseC01
1mseC02 1mseC 1.10.10.60 Molscript image for 1mseC02

[top]
Chain: 1mseA

Sorry the PDB chain 1mseA has been rejected from CATH as it does not pass the SIFT criteria.


[top]
Chain: 1mseB

Sorry the PDB chain 1mseB has been rejected from CATH as it does not pass the SIFT criteria.


[top]
Chain: 1mseC

Chopping figure for chain 1mseC

[top]
Chain: 1mseA

Sorry, we couldn't get FASTA sequence information for '1mseA'. Either the entity '1mseA' does not exist in this version of CATH or it does not pass the SIFT criteria for entry in the database.

[top]
Chain: 1mseB

Sorry, we couldn't get FASTA sequence information for '1mseB'. Either the entity '1mseB' does not exist in this version of CATH or it does not pass the SIFT criteria for entry in the database.

[top]
Chain: 1mseC 

>pdb|1mseC
MLIKGPWTKEEDQRVIKLVQKYGPKRWSVIAKHLKGRIGKQCRERWHNHLNPEVKKTSWTEEEDRIIYQAHKRLGNRWAE
IAKLLPGRTDNAIKNHWNSTMRRKV
BLAST against CATH