PDB: 1mhd XML data for PDB: 1mhd

Molscript image for 1mhd
1mhd
PDB coordinates for PDB 1mhd

PDB 1mhd

CATH Domains (2)

Domain IDChain IDCATH codeImage
1mhdA00 1mhdA 3.90.520.10 Molscript image for 1mhdA00
1mhdB00 1mhdB 3.90.520.10 Molscript image for 1mhdB00

[top]
Chain: 1mhdA

Chopping figure for chain 1mhdA

[top]
Chain: 1mhdB

Chopping figure for chain 1mhdB

[top]
Chain: 1mhdC

Sorry the PDB chain 1mhdC has been rejected from CATH as it does not pass the SIFT criteria.


[top]
Chain: 1mhdD

Sorry the PDB chain 1mhdD has been rejected from CATH as it does not pass the SIFT criteria.


[top]
Chain: 1mhdA 

>pdb|1mhdA
MSSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAITTQNVNTKCITIPRSLDGRLQVSHR
KGLPHVIYCRLWRWPDLHSHHELRAMELCEFAFNMKKDEVCVNPYHYQRVET
BLAST against CATH

[top]
Chain: 1mhdB 

>pdb|1mhdB
MSSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAITTQNVNTKCITIPRSLDGRLQVSHR
KGLPHVIYCRLWRWPDLHSHHELRAMELCEFAFNMKKDEVCVNPYHYQRVET
BLAST against CATH

[top]
Chain: 1mhdC

Sorry, we couldn't get FASTA sequence information for '1mhdC'. Either the entity '1mhdC' does not exist in this version of CATH or it does not pass the SIFT criteria for entry in the database.

[top]
Chain: 1mhdD

Sorry, we couldn't get FASTA sequence information for '1mhdD'. Either the entity '1mhdD' does not exist in this version of CATH or it does not pass the SIFT criteria for entry in the database.