PDB: 1mdy XML data for PDB: 1mdy

Molscript image for 1mdy
1mdy
PDB coordinates for PDB 1mdy

PDB 1mdy

CATH Domains (4)

Domain IDChain IDCATH codeImage
1mdyA00 1mdyA 4.10.280.10 Molscript image for 1mdyA00
1mdyB00 1mdyB 4.10.280.10 Molscript image for 1mdyB00
1mdyC00 1mdyC 4.10.280.10 Molscript image for 1mdyC00
1mdyD00 1mdyD 4.10.280.10 Molscript image for 1mdyD00

[top]
Chain: 1mdyA

Chopping figure for chain 1mdyA

[top]
Chain: 1mdyB

Chopping figure for chain 1mdyB

[top]
Chain: 1mdyC

Chopping figure for chain 1mdyC

[top]
Chain: 1mdyD

Chopping figure for chain 1mdyD

[top]
Chain: 1mdyE

Sorry the PDB chain 1mdyE has been rejected from CATH as it does not pass the SIFT criteria.


[top]
Chain: 1mdyF

Sorry the PDB chain 1mdyF has been rejected from CATH as it does not pass the SIFT criteria.


[top]
Chain: 1mdyG

Sorry the PDB chain 1mdyG has been rejected from CATH as it does not pass the SIFT criteria.


[top]
Chain: 1mdyH

Sorry the PDB chain 1mdyH has been rejected from CATH as it does not pass the SIFT criteria.


[top]
Chain: 1mdyA 

>pdb|1mdyA
MELKRKTTNADRRKAATMRERRRLSKVNEAFETLKRSTSSNPNQRLPKVEILRNAIRYIEGLQALLRD
BLAST against CATH

[top]
Chain: 1mdyB 

>pdb|1mdyB
TTNADRRKAATMRERRRLSKVNEAFETLKRSTSSNPNQRLPKVEILRNAIRYIEGLQALLRD
BLAST against CATH

[top]
Chain: 1mdyC 

>pdb|1mdyC
TTNADRRKAATMRERRRLSKVNEAFETLKRSTSSNPNQRLPKVEILRNAIRYIEGLQALLRD
BLAST against CATH

[top]
Chain: 1mdyD 

>pdb|1mdyD
TTNADRRKAATMRERRRLSKVNEAFETLKRSTSSNPNQRLPKVEILRNAIRYIEGLQALLRD
BLAST against CATH

[top]
Chain: 1mdyE

Sorry, we couldn't get FASTA sequence information for '1mdyE'. Either the entity '1mdyE' does not exist in this version of CATH or it does not pass the SIFT criteria for entry in the database.

[top]
Chain: 1mdyF

Sorry, we couldn't get FASTA sequence information for '1mdyF'. Either the entity '1mdyF' does not exist in this version of CATH or it does not pass the SIFT criteria for entry in the database.

[top]
Chain: 1mdyG

Sorry, we couldn't get FASTA sequence information for '1mdyG'. Either the entity '1mdyG' does not exist in this version of CATH or it does not pass the SIFT criteria for entry in the database.

[top]
Chain: 1mdyH

Sorry, we couldn't get FASTA sequence information for '1mdyH'. Either the entity '1mdyH' does not exist in this version of CATH or it does not pass the SIFT criteria for entry in the database.