PDB: 1lmb
1lmb
PDB 1lmb
CATH Domains (2)
| Domain ID | Chain ID | CATH code | Image |
|---|---|---|---|
| 1lmb300 | 1lmb3 | 1.10.260.40 | |
| 1lmb400 | 1lmb4 | 1.10.260.40 |
Chain: 1lmb1
Sorry the PDB chain 1lmb1 has been rejected from CATH as it does not pass the SIFT criteria.
Chain: 1lmb2
Sorry the PDB chain 1lmb2 has been rejected from CATH as it does not pass the SIFT criteria.
Chain: 1lmb1
Sorry, we couldn't get FASTA sequence information for '1lmb1'. Either the entity '1lmb1' does not exist in this version of CATH or it does not pass the SIFT criteria for entry in the database.
Chain: 1lmb2
Sorry, we couldn't get FASTA sequence information for '1lmb2'. Either the entity '1lmb2' does not exist in this version of CATH or it does not pass the SIFT criteria for entry in the database.
Chain: 1lmb3
>pdb|1lmb3 STKKKPLTQEQLEDARRLKAIYEKKKNELGLSQESVADKMGMGQSGVGALFNGINALNAYNAALLAKILKVSVEEFSPSI AREIYEMYEAVS
