PDB: 1j59 XML data for PDB: 1j59

Molscript image for 1j59
1j59
PDB coordinates for PDB 1j59

PDB 1j59

CATH Domains (4)

Domain IDChain IDCATH codeImage
1j59A01 1j59A 2.60.120.10 Molscript image for 1j59A01
1j59A02 1j59A 1.10.10.10 Molscript image for 1j59A02
1j59B01 1j59B 2.60.120.10 Molscript image for 1j59B01
1j59B02 1j59B 1.10.10.10 Molscript image for 1j59B02

[top]
Chain: 1j59A

Chopping figure for chain 1j59A

[top]
Chain: 1j59B

Chopping figure for chain 1j59B

[top]
Chain: 1j59C

Sorry the PDB chain 1j59C has been rejected from CATH as it does not pass the SIFT criteria.


[top]
Chain: 1j59D

Sorry the PDB chain 1j59D has been rejected from CATH as it does not pass the SIFT criteria.


[top]
Chain: 1j59E

Sorry the PDB chain 1j59E has been rejected from CATH as it does not pass the SIFT criteria.


[top]
Chain: 1j59F

Sorry the PDB chain 1j59F has been rejected from CATH as it does not pass the SIFT criteria.


[top]
Chain: 1j59A 

>pdb|1j59A
VLGKPQTDPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQ
ERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHP
DGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYGTR
BLAST against CATH

[top]
Chain: 1j59B 

>pdb|1j59B
VLGKPQTDPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQ
ERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHP
DGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYGTR
BLAST against CATH

[top]
Chain: 1j59C

Sorry, we couldn't get FASTA sequence information for '1j59C'. Either the entity '1j59C' does not exist in this version of CATH or it does not pass the SIFT criteria for entry in the database.

[top]
Chain: 1j59D

Sorry, we couldn't get FASTA sequence information for '1j59D'. Either the entity '1j59D' does not exist in this version of CATH or it does not pass the SIFT criteria for entry in the database.

[top]
Chain: 1j59E

Sorry, we couldn't get FASTA sequence information for '1j59E'. Either the entity '1j59E' does not exist in this version of CATH or it does not pass the SIFT criteria for entry in the database.

[top]
Chain: 1j59F

Sorry, we couldn't get FASTA sequence information for '1j59F'. Either the entity '1j59F' does not exist in this version of CATH or it does not pass the SIFT criteria for entry in the database.