PDB: 1ihf XML data for PDB: 1ihf

Molscript image for 1ihf
1ihf
PDB coordinates for PDB 1ihf

PDB 1ihf

CATH Domains (2)

Domain IDChain IDCATH codeImage
1ihfA00 1ihfA 4.10.520.10 Molscript image for 1ihfA00
1ihfB00 1ihfB 4.10.520.10 Molscript image for 1ihfB00

[top]
Chain: 1ihfA

Chopping figure for chain 1ihfA

[top]
Chain: 1ihfB

Chopping figure for chain 1ihfB

[top]
Chain: 1ihfC

Sorry the PDB chain 1ihfC has been rejected from CATH as it does not pass the SIFT criteria.


[top]
Chain: 1ihfD

Sorry the PDB chain 1ihfD has been rejected from CATH as it does not pass the SIFT criteria.


[top]
Chain: 1ihfE

Sorry the PDB chain 1ihfE has been rejected from CATH as it does not pass the SIFT criteria.


[top]
Chain: 1ihfA 

>pdb|1ihfA
MALTKAEMSEYLFDKLGLSKRDAKELVELFFEEIRRALENGEQVKLSGFGNFDLRDKNQRPGRNPKTGEDIPITARRVVT
FRPGQKLKSRVENASPKDE
BLAST against CATH

[top]
Chain: 1ihfB 

>pdb|1ihfB
MTKSELIERLATQQSHIPAKTVEDAVKEMLEHMASTLAQGERIEIRGFGSFSLHYRAPRTGRNPKTGDKVELEGKYVPHF
KPGKELRDRANIYG
BLAST against CATH

[top]
Chain: 1ihfC

Sorry, we couldn't get FASTA sequence information for '1ihfC'. Either the entity '1ihfC' does not exist in this version of CATH or it does not pass the SIFT criteria for entry in the database.

[top]
Chain: 1ihfD

Sorry, we couldn't get FASTA sequence information for '1ihfD'. Either the entity '1ihfD' does not exist in this version of CATH or it does not pass the SIFT criteria for entry in the database.

[top]
Chain: 1ihfE

Sorry, we couldn't get FASTA sequence information for '1ihfE'. Either the entity '1ihfE' does not exist in this version of CATH or it does not pass the SIFT criteria for entry in the database.