PDB: 1ign XML data for PDB: 1ign

Molscript image for 1ign
1ign
PDB coordinates for PDB 1ign

PDB 1ign

CATH Domains (4)

Domain IDChain IDCATH codeImage
1ignA01 1ignA 1.10.10.60 Molscript image for 1ignA01
1ignA02 1ignA 1.10.10.60 Molscript image for 1ignA02
1ignB01 1ignB 1.10.10.60 Molscript image for 1ignB01
1ignB02 1ignB 1.10.10.60 Molscript image for 1ignB02

[top]
Chain: 1ignA

Chopping figure for chain 1ignA

[top]
Chain: 1ignB

Chopping figure for chain 1ignB

[top]
Chain: 1ignC

Sorry the PDB chain 1ignC has been rejected from CATH as it does not pass the SIFT criteria.


[top]
Chain: 1ignD

Sorry the PDB chain 1ignD has been rejected from CATH as it does not pass the SIFT criteria.


[top]
Chain: 1ignE

Sorry the PDB chain 1ignE has been rejected from CATH as it does not pass the SIFT criteria.


[top]
Chain: 1ignF

Sorry the PDB chain 1ignF has been rejected from CATH as it does not pass the SIFT criteria.


[top]
Chain: 1ignA 

>pdb|1ignA
GALPSHNKASFTDEEDEFILDVVRKNPTRRTTHTLYDEISHYVPNHTGNSIRHRFRVYLSKRLEYVYEVDKFGKLVRDDD
GNLIKTKVLPPSIKRKFSADEDYTLAIAVKKQFYRDLFQIDPDTGRSLIRTQSRRGPIAREFFKHFAEEHAAHTENAWRD
RFRKFLLAYGIDDYISYYEAEKAQNREPEPMKNLTNRPKRPGVPTPGNYNSAAKR
BLAST against CATH

[top]
Chain: 1ignB 

>pdb|1ignB
GALPSHNKASFTDEEDEFILDVVRKNPTRRTTHTLYDEISHYVPNHTGNSIRHRFRVYLSKRLEYVYEVDKFGKLVRDDD
GNLIKTKVLPPSIKRKFSADEDYTLAIAVKKQFYRDLFQIDPDTGRSLIRTQSRRGPIAREFFKHFAEEHAAHTENAWRD
RFRKFLLAYGIDDYISYYEAEKAQNREPEPMKNLTNRPKRPGVPTPGNYNSAAKR
BLAST against CATH

[top]
Chain: 1ignC

Sorry, we couldn't get FASTA sequence information for '1ignC'. Either the entity '1ignC' does not exist in this version of CATH or it does not pass the SIFT criteria for entry in the database.

[top]
Chain: 1ignD

Sorry, we couldn't get FASTA sequence information for '1ignD'. Either the entity '1ignD' does not exist in this version of CATH or it does not pass the SIFT criteria for entry in the database.

[top]
Chain: 1ignE

Sorry, we couldn't get FASTA sequence information for '1ignE'. Either the entity '1ignE' does not exist in this version of CATH or it does not pass the SIFT criteria for entry in the database.

[top]
Chain: 1ignF

Sorry, we couldn't get FASTA sequence information for '1ignF'. Either the entity '1ignF' does not exist in this version of CATH or it does not pass the SIFT criteria for entry in the database.