PDB: 1if1 XML data for PDB: 1if1

Molscript image for 1if1
1if1
PDB coordinates for PDB 1if1

PDB 1if1

CATH Domains (2)

Domain IDChain IDCATH codeImage
1if1A00 1if1A 1.10.10.10 Molscript image for 1if1A00
1if1B00 1if1B 1.10.10.10 Molscript image for 1if1B00

[top]
Chain: 1if1A

Chopping figure for chain 1if1A

[top]
Chain: 1if1B

Chopping figure for chain 1if1B

[top]
Chain: 1if1C

Sorry the PDB chain 1if1C has been rejected from CATH as it does not pass the SIFT criteria.


[top]
Chain: 1if1D

Sorry the PDB chain 1if1D has been rejected from CATH as it does not pass the SIFT criteria.


[top]
Chain: 1if1A 

>pdb|1if1A
MPITWMRMRPWLEMQINSNQIPGLIWINKEEMIFQIPWKHAAKHGWDINKDACLFRSWAIHTGRYKAGEKEPDPKTWKAN
FRCAMNSLPDIEEVKDQSRNKGSSAVRVYRMLP
BLAST against CATH

[top]
Chain: 1if1B 

>pdb|1if1B
MPITWMRMRPWLEMQINSNQIPGLIWINKEEMIFQIPWKHAAKHGWDINKDACLFRSWAIHTGRYKAGEKEPDPKTWKAN
FRCAMNSLPDIEEVKDQSRNKGSSAVRVYRMLP
BLAST against CATH

[top]
Chain: 1if1C

Sorry, we couldn't get FASTA sequence information for '1if1C'. Either the entity '1if1C' does not exist in this version of CATH or it does not pass the SIFT criteria for entry in the database.

[top]
Chain: 1if1D

Sorry, we couldn't get FASTA sequence information for '1if1D'. Either the entity '1if1D' does not exist in this version of CATH or it does not pass the SIFT criteria for entry in the database.