PDB: 1hwt
1hwt
PDB 1hwt
CATH Domains (0)
Chain: 1hwtA
Sorry the PDB chain 1hwtA has been rejected from CATH as it does not pass the SIFT criteria.
Chain: 1hwtB
Sorry the PDB chain 1hwtB has been rejected from CATH as it does not pass the SIFT criteria.
Chain: 1hwtE
Sorry the PDB chain 1hwtE has been rejected from CATH as it does not pass the SIFT criteria.
Chain: 1hwtF
Sorry the PDB chain 1hwtF has been rejected from CATH as it does not pass the SIFT criteria.
Chain: 1hwtA
Sorry, we couldn't get FASTA sequence information for '1hwtA'. Either the entity '1hwtA' does not exist in this version of CATH or it does not pass the SIFT criteria for entry in the database.
Chain: 1hwtB
Sorry, we couldn't get FASTA sequence information for '1hwtB'. Either the entity '1hwtB' does not exist in this version of CATH or it does not pass the SIFT criteria for entry in the database.
Chain: 1hwtC
>pdb|1hwtC RKRNRIPLSCTICRKRKVKCDKLRPHCQQCTKTGVAHLCHYMEQTWAEEAEKELLKDNELKKLRERVKSLEKTLSKVHSS P
Chain: 1hwtD
>pdb|1hwtD RKRNRIPLSCTICRKRKVKCDKLRPHCQQCTKTGVAHLCHYMEQTWAEEAEKELLKDNELKKLRERVKSLEKTLSKVHSS P
Chain: 1hwtE
Sorry, we couldn't get FASTA sequence information for '1hwtE'. Either the entity '1hwtE' does not exist in this version of CATH or it does not pass the SIFT criteria for entry in the database.
Chain: 1hwtF
Sorry, we couldn't get FASTA sequence information for '1hwtF'. Either the entity '1hwtF' does not exist in this version of CATH or it does not pass the SIFT criteria for entry in the database.
Chain: 1hwtG
>pdb|1hwtG RKRNRIPLSCTICRKRKVKCDKLRPHCQQCTKTGVAHLCHYMEQTWAEEAEKELLKDNELKKLRERVKSLEKTLSKVHSS P
