PDB: 1hry XML data for PDB: 1hry

Molscript image for 1hry
1hry
PDB coordinates for PDB 1hry

PDB 1hry

CATH Domains (1)

Domain IDChain IDCATH codeImage
1hryA00 1hryA 1.10.30.10 Molscript image for 1hryA00

[top]
Chain: 1hryA

Chopping figure for chain 1hryA

[top]
Chain: 1hryB

Sorry the PDB chain 1hryB has been rejected from CATH as it does not pass the SIFT criteria.


[top]
Chain: 1hryC

Sorry the PDB chain 1hryC has been rejected from CATH as it does not pass the SIFT criteria.


[top]
Chain: 1hryA 

>pdb|1hryA
VQDRVKRPMNAFIVWSRDQRRKMALENPRMRNSEISKQLGYQWKMLTEAEKWPFFQEAQKLQAMHREKYPNYKYRP
BLAST against CATH

[top]
Chain: 1hryB

Sorry, we couldn't get FASTA sequence information for '1hryB'. Either the entity '1hryB' does not exist in this version of CATH or it does not pass the SIFT criteria for entry in the database.

[top]
Chain: 1hryC

Sorry, we couldn't get FASTA sequence information for '1hryC'. Either the entity '1hryC' does not exist in this version of CATH or it does not pass the SIFT criteria for entry in the database.