PDB: 1hdd XML data for PDB: 1hdd

Molscript image for 1hdd
1hdd
PDB coordinates for PDB 1hdd

PDB 1hdd

CATH Domains (2)

Domain IDChain IDCATH codeImage
1hddC00 1hddC 1.10.10.60 Molscript image for 1hddC00
1hddD00 1hddD 1.10.10.60 Molscript image for 1hddD00

Chain: 1hddA

Sorry the PDB chain 1hddA has been rejected from CATH as it does not pass the SIFT criteria.


Chain: 1hddB

Sorry the PDB chain 1hddB has been rejected from CATH as it does not pass the SIFT criteria.


Chain: 1hddC

Chopping figure for chain 1hddC

Chain: 1hddD

Chopping figure for chain 1hddD

Chain: 1hddA

Sorry, we couldn't get FASTA sequence information for '1hddA'. Either the entity '1hddA' does not exist in this version of CATH or it does not pass the SIFT criteria for entry in the database.

Chain: 1hddB

Sorry, we couldn't get FASTA sequence information for '1hddB'. Either the entity '1hddB' does not exist in this version of CATH or it does not pass the SIFT criteria for entry in the database.

Chain: 1hddC

>pdb|1hddC
MDEKRPRTAFSSEQLARLKREFNENRYLTERRRQQLSSELGLNEAQIKIWFQNKRAKIKKS    

Chain: 1hddD

>pdb|1hddD
MDEKRPRTAFSSEQLARLKREFNENRYLTERRRQQLSSELGLNEAQIKIWFQNKRAKIKKS