PDB: 1hcr XML data for PDB: 1hcr

Molscript image for 1hcr
1hcr
PDB coordinates for PDB 1hcr

PDB 1hcr

CATH Domains (1)

Domain IDChain IDCATH codeImage
1hcrA00 1hcrA 1.10.10.60 Molscript image for 1hcrA00

[top]
Chain: 1hcrA

Chopping figure for chain 1hcrA

[top]
Chain: 1hcrB

Sorry the PDB chain 1hcrB has been rejected from CATH as it does not pass the SIFT criteria.


[top]
Chain: 1hcrC

Sorry the PDB chain 1hcrC has been rejected from CATH as it does not pass the SIFT criteria.


[top]
Chain: 1hcrA 

>pdb|1hcrA
GRPRAINKHEQEQISRLLEKGHPRQQLAIIFGIGVSTLYRYFPASSIKKRMN
BLAST against CATH

[top]
Chain: 1hcrB

Sorry, we couldn't get FASTA sequence information for '1hcrB'. Either the entity '1hcrB' does not exist in this version of CATH or it does not pass the SIFT criteria for entry in the database.

[top]
Chain: 1hcrC

Sorry, we couldn't get FASTA sequence information for '1hcrC'. Either the entity '1hcrC' does not exist in this version of CATH or it does not pass the SIFT criteria for entry in the database.