PDB: 1hcq XML data for PDB: 1hcq

Molscript image for 1hcq
1hcq
PDB coordinates for PDB 1hcq

PDB 1hcq

CATH Domains (4)

Domain IDChain IDCATH codeImage
1hcqA00 1hcqA 3.30.50.10 Molscript image for 1hcqA00
1hcqB00 1hcqB 3.30.50.10 Molscript image for 1hcqB00
1hcqE00 1hcqE 3.30.50.10 Molscript image for 1hcqE00
1hcqF00 1hcqF 3.30.50.10 Molscript image for 1hcqF00

Chain: 1hcqA

Chopping figure for chain 1hcqA

Chain: 1hcqB

Chopping figure for chain 1hcqB

Chain: 1hcqC

Sorry the PDB chain 1hcqC has been rejected from CATH as it does not pass the SIFT criteria.


Chain: 1hcqD

Sorry the PDB chain 1hcqD has been rejected from CATH as it does not pass the SIFT criteria.


Chain: 1hcqE

Chopping figure for chain 1hcqE

Chain: 1hcqF

Chopping figure for chain 1hcqF

Chain: 1hcqG

Sorry the PDB chain 1hcqG has been rejected from CATH as it does not pass the SIFT criteria.


Chain: 1hcqH

Sorry the PDB chain 1hcqH has been rejected from CATH as it does not pass the SIFT criteria.


Chain: 1hcqA

>pdb|1hcqA
MKETRYCAVCNDYASGYHYGVWSCEGCKAFFKRSIQGHNDYMCPATNQCTIDKNRRKSCQACRLRKCYEVGMMKGGIRKD
RRGG    

Chain: 1hcqB

>pdb|1hcqB
MKETRYCAVCNDYASGYHYGVWSCEGCKAFFKRSIQGHNDYMCPATNQCTIDKNRRKSCQACRLRKCYEVGMMKGGIRKD
RRGG    

Chain: 1hcqC

Sorry, we couldn't get FASTA sequence information for '1hcqC'. Either the entity '1hcqC' does not exist in this version of CATH or it does not pass the SIFT criteria for entry in the database.

Chain: 1hcqD

Sorry, we couldn't get FASTA sequence information for '1hcqD'. Either the entity '1hcqD' does not exist in this version of CATH or it does not pass the SIFT criteria for entry in the database.

Chain: 1hcqE

>pdb|1hcqE
MKETRYCAVCNDYASGYHYGVWSCEGCKAFFKRSIQGHNDYMCPATNQCTIDKNRRKSCQACRLRKCYEVGMMKGGIRKD
RRGG    

Chain: 1hcqF

>pdb|1hcqF
MKETRYCAVCNDYASGYHYGVWSCEGCKAFFKRSIQGHNDYMCPATNQCTIDKNRRKSCQACRLRKCYEVGMMKGGIRKD
RRGG    

Chain: 1hcqG

Sorry, we couldn't get FASTA sequence information for '1hcqG'. Either the entity '1hcqG' does not exist in this version of CATH or it does not pass the SIFT criteria for entry in the database.

Chain: 1hcqH

Sorry, we couldn't get FASTA sequence information for '1hcqH'. Either the entity '1hcqH' does not exist in this version of CATH or it does not pass the SIFT criteria for entry in the database.