PDB: 1gdt XML data for PDB: 1gdt

Molscript image for 1gdt
1gdt
PDB coordinates for PDB 1gdt

PDB 1gdt

CATH Domains (6)

Domain IDChain IDCATH codeImage
1gdtA01 1gdtA 3.40.50.1390 Molscript image for 1gdtA01
1gdtA02 1gdtA 1.20.5.40 Molscript image for 1gdtA02
1gdtA03 1gdtA 1.10.10.60 Molscript image for 1gdtA03
1gdtB01 1gdtB 3.40.50.1390 Molscript image for 1gdtB01
1gdtB02 1gdtB 1.20.5.40 Molscript image for 1gdtB02
1gdtB03 1gdtB 1.10.10.60 Molscript image for 1gdtB03

[top]
Chain: 1gdtA

Chopping figure for chain 1gdtA

[top]
Chain: 1gdtB

Chopping figure for chain 1gdtB

[top]
Chain: 1gdtC

Sorry the PDB chain 1gdtC has been rejected from CATH as it does not pass the SIFT criteria.


[top]
Chain: 1gdtD

Sorry the PDB chain 1gdtD has been rejected from CATH as it does not pass the SIFT criteria.


[top]
Chain: 1gdtE

Sorry the PDB chain 1gdtE has been rejected from CATH as it does not pass the SIFT criteria.


[top]
Chain: 1gdtF

Sorry the PDB chain 1gdtF has been rejected from CATH as it does not pass the SIFT criteria.


[top]
Chain: 1gdtA 

>pdb|1gdtA
MRLFGYARVSTSQQSLDIQVRALKDAGVKANRIFTDKASGSSSDRKGLDLLRMKVEEGDVILVKKLDRLGRDTADMIQLI
KEFDAQGVSIRFIDDGISTDGEMGKMVVTILSAVAQAERQRILERTNEGRQEAMAKGVVFGRKRKIDRDAVLNMWQQGLG
ASHISKTMNIARSTVYKVINESN
BLAST against CATH

[top]
Chain: 1gdtB 

>pdb|1gdtB
MRLFGYARVSTSQQSLDIQVRALKDAGVKANRIFTDKASGSSSDRKGLDLLRMKVEEGDVILVKKLDRLGRDTADMIQLI
KEFDAQGVSIRFIDDGISTDGEMGKMVVTILSAVAQAERQRILERTNEGRQEAMAKGVVFGRKRKIDRDAVLNMWQQGLG
ASHISKTMNIARSTVYKVINESN
BLAST against CATH

[top]
Chain: 1gdtC

Sorry, we couldn't get FASTA sequence information for '1gdtC'. Either the entity '1gdtC' does not exist in this version of CATH or it does not pass the SIFT criteria for entry in the database.

[top]
Chain: 1gdtD

Sorry, we couldn't get FASTA sequence information for '1gdtD'. Either the entity '1gdtD' does not exist in this version of CATH or it does not pass the SIFT criteria for entry in the database.

[top]
Chain: 1gdtE

Sorry, we couldn't get FASTA sequence information for '1gdtE'. Either the entity '1gdtE' does not exist in this version of CATH or it does not pass the SIFT criteria for entry in the database.

[top]
Chain: 1gdtF

Sorry, we couldn't get FASTA sequence information for '1gdtF'. Either the entity '1gdtF' does not exist in this version of CATH or it does not pass the SIFT criteria for entry in the database.