PDB: 1gcc XML data for PDB: 1gcc

Molscript image for 1gcc
1gcc
PDB coordinates for PDB 1gcc

PDB 1gcc

CATH Domains (1)

Domain IDChain IDCATH codeImage
1gccA00 1gccA 3.30.730.10 Molscript image for 1gccA00

[top]
Chain: 1gccA

Chopping figure for chain 1gccA

[top]
Chain: 1gccB

Sorry the PDB chain 1gccB has been rejected from CATH as it does not pass the SIFT criteria.


[top]
Chain: 1gccC

Sorry the PDB chain 1gccC has been rejected from CATH as it does not pass the SIFT criteria.


[top]
Chain: 1gccA 

>pdb|1gccA
KHYRGVRQRPWGKFAAEIRDPAKNGARVWLGTFETAEDAALAYDRAAFRMRGSRALLNFPLRV
BLAST against CATH

[top]
Chain: 1gccB

Sorry, we couldn't get FASTA sequence information for '1gccB'. Either the entity '1gccB' does not exist in this version of CATH or it does not pass the SIFT criteria for entry in the database.

[top]
Chain: 1gccC

Sorry, we couldn't get FASTA sequence information for '1gccC'. Either the entity '1gccC' does not exist in this version of CATH or it does not pass the SIFT criteria for entry in the database.