PDB: 1gat XML data for PDB: 1gat

Molscript image for 1gat
1gat
PDB coordinates for PDB 1gat

PDB 1gat

CATH Domains (1)

Domain IDChain IDCATH codeImage
1gatA00 1gatA 3.30.50.10 Molscript image for 1gatA00

[top]
Chain: 1gatA

Chopping figure for chain 1gatA

[top]
Chain: 1gatB

Sorry the PDB chain 1gatB has been rejected from CATH as it does not pass the SIFT criteria.


[top]
Chain: 1gatC

Sorry the PDB chain 1gatC has been rejected from CATH as it does not pass the SIFT criteria.


[top]
Chain: 1gatA 

>pdb|1gatA
KRAGTVCSNCQTSTTTLWRRSPMGDPVCNACGLYYKLHQVNRPLTMRKDGIQTRNRKVSS
BLAST against CATH

[top]
Chain: 1gatB

Sorry, we couldn't get FASTA sequence information for '1gatB'. Either the entity '1gatB' does not exist in this version of CATH or it does not pass the SIFT criteria for entry in the database.

[top]
Chain: 1gatC

Sorry, we couldn't get FASTA sequence information for '1gatC'. Either the entity '1gatC' does not exist in this version of CATH or it does not pass the SIFT criteria for entry in the database.