PDB: 1fjl XML data for PDB: 1fjl

Molscript image for 1fjl
1fjl
PDB coordinates for PDB 1fjl

PDB 1fjl

CATH Domains (3)

Domain IDChain IDCATH codeImage
1fjlA00 1fjlA 1.10.10.60 Molscript image for 1fjlA00
1fjlB00 1fjlB 1.10.10.60 Molscript image for 1fjlB00
1fjlC00 1fjlC 1.10.10.60 Molscript image for 1fjlC00

[top]
Chain: 1fjlA

Chopping figure for chain 1fjlA

[top]
Chain: 1fjlB

Chopping figure for chain 1fjlB

[top]
Chain: 1fjlC

Chopping figure for chain 1fjlC

[top]
Chain: 1fjlD

Sorry the PDB chain 1fjlD has been rejected from CATH as it does not pass the SIFT criteria.


[top]
Chain: 1fjlE

Sorry the PDB chain 1fjlE has been rejected from CATH as it does not pass the SIFT criteria.


[top]
Chain: 1fjlF

Sorry the PDB chain 1fjlF has been rejected from CATH as it does not pass the SIFT criteria.


[top]
Chain: 1fjlA 

>pdb|1fjlA
KQRRSRTTFSASQLDELERAFERTQYPDIYTREELAQRTNLTEARIQVWFQNRRARLRKQHTSVS
BLAST against CATH

[top]
Chain: 1fjlB 

>pdb|1fjlB
QRRSRTTFSASQLDELERAFERTQYPDIYTREELAQRTNLTEARIQVWFQNRRARLRKQHTSVS
BLAST against CATH

[top]
Chain: 1fjlC 

>pdb|1fjlC
KQRRSRTTFSASQLDELERAFERTQYPDIYTREELAQRTNLTEARIQVWFQNRRARLRKQHTSVS
BLAST against CATH

[top]
Chain: 1fjlD

Sorry, we couldn't get FASTA sequence information for '1fjlD'. Either the entity '1fjlD' does not exist in this version of CATH or it does not pass the SIFT criteria for entry in the database.

[top]
Chain: 1fjlE

Sorry, we couldn't get FASTA sequence information for '1fjlE'. Either the entity '1fjlE' does not exist in this version of CATH or it does not pass the SIFT criteria for entry in the database.

[top]
Chain: 1fjlF

Sorry, we couldn't get FASTA sequence information for '1fjlF'. Either the entity '1fjlF' does not exist in this version of CATH or it does not pass the SIFT criteria for entry in the database.