PDB: 1dp7 XML data for PDB: 1dp7

Molscript image for 1dp7
1dp7
PDB coordinates for PDB 1dp7

PDB 1dp7

CATH Domains (1)

Domain IDChain IDCATH codeImage
1dp7P00 1dp7P 1.10.10.10 Molscript image for 1dp7P00

Chain: 1dp7D

Sorry the PDB chain 1dp7D has been rejected from CATH as it does not pass the SIFT criteria.


Chain: 1dp7P

Chopping figure for chain 1dp7P

Chain: 1dp7D

Sorry, we couldn't get FASTA sequence information for '1dp7D'. Either the entity '1dp7D' does not exist in this version of CATH or it does not pass the SIFT criteria for entry in the database.

Chain: 1dp7P

>pdb|1dp7P
TVQWLLDNYETAEGVSLPRSTLYNHYLLHSQEQKLEPVNAASFGKLIRSVFMGLRTRRLGTRGNSKYHYYGLRIKA