PDB: 1d02 XML data for PDB: 1d02

Molscript image for 1d02
1d02
PDB coordinates for PDB 1d02

PDB 1d02

CATH Domains (2)

Domain IDChain IDCATH codeImage
1d02A00 1d02A 3.40.580.10 Molscript image for 1d02A00
1d02B00 1d02B 3.40.580.10 Molscript image for 1d02B00

[top]
Chain: 1d02A

Chopping figure for chain 1d02A

[top]
Chain: 1d02B

Chopping figure for chain 1d02B

[top]
Chain: 1d02C

Sorry the PDB chain 1d02C has been rejected from CATH as it does not pass the SIFT criteria.


[top]
Chain: 1d02D

Sorry the PDB chain 1d02D has been rejected from CATH as it does not pass the SIFT criteria.


[top]
Chain: 1d02A 

>pdb|1d02A
MGKSELSGRLNWQALAGLKASGAEQNLYNVFNAVFEGTKYVLYEKPKHLKNLYAQVVLPDDVIKEIFNPLIDLSTTQWGV
SPAFAIENTETHKILFGEIKRQDGWVEGKDPSAGRGNAHERSCKLFTPGLLKAYRTIGGINDEEILPFWVVFEGDITRDP
KRVREITFWYDHYQDNYFMWRPNESGEKLVQHFNEKLKKYLD
BLAST against CATH

[top]
Chain: 1d02B 

>pdb|1d02B
MGKSELSGRLNWQALAGLKASGAEQNLYNVFNAVFEGTKYVLYEKPKHLKNLYAQVVLPDDVIKEIFNPLIDLSTTQWGV
SPAFAIENTETHKILFGEIKRQDGWVEGKDPSAGRGNAHERSCKLFTPGLLKAYRTIGGINDEEILPFWVVFEGDITRDP
KRVREITFWYDHYQDNYFMWRPNESGEKLVQHFNEKLKKYLD
BLAST against CATH

[top]
Chain: 1d02C

Sorry, we couldn't get FASTA sequence information for '1d02C'. Either the entity '1d02C' does not exist in this version of CATH or it does not pass the SIFT criteria for entry in the database.

[top]
Chain: 1d02D

Sorry, we couldn't get FASTA sequence information for '1d02D'. Either the entity '1d02D' does not exist in this version of CATH or it does not pass the SIFT criteria for entry in the database.