PDB: 1cma XML data for PDB: 1cma

Molscript image for 1cma
1cma
PDB coordinates for PDB 1cma

PDB 1cma

CATH Domains (2)

Domain IDChain IDCATH codeImage
1cmaA00 1cmaA 1.10.140.10 Molscript image for 1cmaA00
1cmaB00 1cmaB 1.10.140.10 Molscript image for 1cmaB00

[top]
Chain: 1cmaA

Chopping figure for chain 1cmaA

[top]
Chain: 1cmaB

Chopping figure for chain 1cmaB

[top]
Chain: 1cmaC

Sorry the PDB chain 1cmaC has been rejected from CATH as it does not pass the SIFT criteria.


[top]
Chain: 1cmaD

Sorry the PDB chain 1cmaD has been rejected from CATH as it does not pass the SIFT criteria.


[top]
Chain: 1cmaA 

>pdb|1cmaA
AEWSGEYISPYAEHGKKSEQVKKITVSIPLKVLKILTDERTRRQVNNLRHATNSELLCEAFLHAFTGQPLPDDADLRKER
SDEIPEAAKEIMREMGINPETWEY
BLAST against CATH

[top]
Chain: 1cmaB 

>pdb|1cmaB
AEWSGEYISPYAEHGKKSEQVKKITVSIPLKVLKILTDERTRRQVNNLRHATNSELLCEAFLHAFTGQPLPDDADLRKER
SDEIPEAAKEIMREMGINPETWEY
BLAST against CATH

[top]
Chain: 1cmaC

Sorry, we couldn't get FASTA sequence information for '1cmaC'. Either the entity '1cmaC' does not exist in this version of CATH or it does not pass the SIFT criteria for entry in the database.

[top]
Chain: 1cmaD

Sorry, we couldn't get FASTA sequence information for '1cmaD'. Either the entity '1cmaD' does not exist in this version of CATH or it does not pass the SIFT criteria for entry in the database.