PDB: 1cl8 XML data for PDB: 1cl8

Molscript image for 1cl8
1cl8
PDB coordinates for PDB 1cl8

PDB 1cl8

CATH Domains (1)

Domain IDChain IDCATH codeImage
1cl8A00 1cl8A 3.40.580.10 Molscript image for 1cl8A00

[top]
Chain: 1cl8A

Chopping figure for chain 1cl8A

[top]
Chain: 1cl8B

Sorry the PDB chain 1cl8B has been rejected from CATH as it does not pass the SIFT criteria.


[top]
Chain: 1cl8A 

>pdb|1cl8A
SNKKQSNRLTEQHKLSQGVIGIFGDYAKAHDLAVGEVSKLVKKALSNEYPQLSFRYRDSIKKTEINEALKKIDPDLGGTL
FVSNSSIKPDGGIVEVKDDYGEWRVVLVAEAKHQGKDIINIRNGLLVGKRGDQDLMAAGNAIERSHKNISEIANFMLSES
HFPYVLFLEGSNFLTENISITRPDGRVVNLEYNSGILNRLDRLTAANYGMPINSNLCINKFVNHKDKSIMLQAASIYTQG
DGREWDSKIMFEIMFDISTTSLRVLGRDLFEQLTSK
BLAST against CATH

[top]
Chain: 1cl8B

Sorry, we couldn't get FASTA sequence information for '1cl8B'. Either the entity '1cl8B' does not exist in this version of CATH or it does not pass the SIFT criteria for entry in the database.