PDB: 1cf7 XML data for PDB: 1cf7

Molscript image for 1cf7
1cf7
PDB coordinates for PDB 1cf7

PDB 1cf7

CATH Domains (2)

Domain IDChain IDCATH codeImage
1cf7A00 1cf7A 1.10.10.10 Molscript image for 1cf7A00
1cf7B00 1cf7B 1.10.10.10 Molscript image for 1cf7B00

[top]
Chain: 1cf7A

Chopping figure for chain 1cf7A

[top]
Chain: 1cf7B

Chopping figure for chain 1cf7B

[top]
Chain: 1cf7C

Sorry the PDB chain 1cf7C has been rejected from CATH as it does not pass the SIFT criteria.


[top]
Chain: 1cf7D

Sorry the PDB chain 1cf7D has been rejected from CATH as it does not pass the SIFT criteria.


[top]
Chain: 1cf7A 

>pdb|1cf7A
PPGTPSRHEKSLGLLTTKFVSLLQEAKDGVLDLKLAADTLAVRQKRRIYDITNVLEGIGLIEKKSKNSIQWKGVGP
BLAST against CATH

[top]
Chain: 1cf7B 

>pdb|1cf7B
RSKKGDKNGKGLRHFSMKVCEKVQRKGTTSYNEVADELVSEFTNSNNHLAADSAYDQKNIRRRVYDALNVLMAMNIISKE
KKEIKWIGLPTNSAQ
BLAST against CATH

[top]
Chain: 1cf7C

Sorry, we couldn't get FASTA sequence information for '1cf7C'. Either the entity '1cf7C' does not exist in this version of CATH or it does not pass the SIFT criteria for entry in the database.

[top]
Chain: 1cf7D

Sorry, we couldn't get FASTA sequence information for '1cf7D'. Either the entity '1cf7D' does not exist in this version of CATH or it does not pass the SIFT criteria for entry in the database.