PDB: 1cdw XML data for PDB: 1cdw

Molscript image for 1cdw
1cdw
PDB coordinates for PDB 1cdw

PDB 1cdw

CATH Domains (2)

Domain IDChain IDCATH codeImage
1cdwA01 1cdwA 3.30.310.10 Molscript image for 1cdwA01
1cdwA02 1cdwA 3.30.310.10 Molscript image for 1cdwA02

[top]
Chain: 1cdwA

Chopping figure for chain 1cdwA

[top]
Chain: 1cdwB

Sorry the PDB chain 1cdwB has been rejected from CATH as it does not pass the SIFT criteria.


[top]
Chain: 1cdwC

Sorry the PDB chain 1cdwC has been rejected from CATH as it does not pass the SIFT criteria.


[top]
Chain: 1cdwA 

>pdb|1cdwA
SGIVPQLQNIVSTVNLGCKLDLKTIALRARNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEENSRLAARKYA
RVVQKLGFPAKFLDFKIQNMVGSCDVKFPIRLEGLVLTHQQFSSYEPELFPGLIYRMIKPRIVLLIFVSGKVVLTGAKVR
AEIYEAFENIYPILKGFRK
BLAST against CATH

[top]
Chain: 1cdwB

Sorry, we couldn't get FASTA sequence information for '1cdwB'. Either the entity '1cdwB' does not exist in this version of CATH or it does not pass the SIFT criteria for entry in the database.

[top]
Chain: 1cdwC

Sorry, we couldn't get FASTA sequence information for '1cdwC'. Either the entity '1cdwC' does not exist in this version of CATH or it does not pass the SIFT criteria for entry in the database.