PDB: 1bl0 XML data for PDB: 1bl0

Molscript image for 1bl0
1bl0
PDB coordinates for PDB 1bl0

PDB 1bl0

CATH Domains (2)

Domain IDChain IDCATH codeImage
1bl0A01 1bl0A 1.10.10.60 Molscript image for 1bl0A01
1bl0A02 1bl0A 1.10.10.60 Molscript image for 1bl0A02

[top]
Chain: 1bl0A

Chopping figure for chain 1bl0A

[top]
Chain: 1bl0B

Sorry the PDB chain 1bl0B has been rejected from CATH as it does not pass the SIFT criteria.


[top]
Chain: 1bl0C

Sorry the PDB chain 1bl0C has been rejected from CATH as it does not pass the SIFT criteria.


[top]
Chain: 1bl0A 

>pdb|1bl0A
MTMSRRNTDAITIHSILDWIEDNLESPLSLEKVSERSGYSKWHLQRMFKKETGHSLGQYIRSRKMTEIAQKLKESNEPIL
YLAERYGFESQQTLTRTFKNYFDVPPHKYRMTNMQGESRFLHPLNHYNS
BLAST against CATH

[top]
Chain: 1bl0B

Sorry, we couldn't get FASTA sequence information for '1bl0B'. Either the entity '1bl0B' does not exist in this version of CATH or it does not pass the SIFT criteria for entry in the database.

[top]
Chain: 1bl0C

Sorry, we couldn't get FASTA sequence information for '1bl0C'. Either the entity '1bl0C' does not exist in this version of CATH or it does not pass the SIFT criteria for entry in the database.