PDB: 1b3t XML data for PDB: 1b3t

Molscript image for 1b3t
1b3t
PDB coordinates for PDB 1b3t

PDB 1b3t

CATH Domains (2)

Domain IDChain IDCATH codeImage
1b3tA00 1b3tA 3.30.70.390 Molscript image for 1b3tA00
1b3tB00 1b3tB 3.30.70.390 Molscript image for 1b3tB00

[top]
Chain: 1b3tA

Chopping figure for chain 1b3tA

[top]
Chain: 1b3tB

Chopping figure for chain 1b3tB

[top]
Chain: 1b3tC

Sorry the PDB chain 1b3tC has been rejected from CATH as it does not pass the SIFT criteria.


[top]
Chain: 1b3tD

Sorry the PDB chain 1b3tD has been rejected from CATH as it does not pass the SIFT criteria.


[top]
Chain: 1b3tA 

>pdb|1b3tA
KGGWFGKHRGQGGSNPKFENIAEGLRALLARSHVERTTDEGTWVAGVFVYGGSKTSLYNLRRGTALAIPQCRLTPLSRLP
FGMAPGPGPQPGPLRESIVCYFMVFLQTHIFAEVLKDAIKDLVMTKPAPTCNIRVTVCSFDDGVDLP
BLAST against CATH

[top]
Chain: 1b3tB 

>pdb|1b3tB
KGGWFGKHRGQGGSNPKFENIAEGLRALLARSHVERTTDEGTWVAGVFVYGGSKTSLYNLRRGTALAIPQCRLTPLSRLP
FGMAPGPGPQPGPLRESIVCYFMVFLQTHIFAEVLKDAIKDLVMTKPAPTCNIRVTVCSFDDGVDLP
BLAST against CATH

[top]
Chain: 1b3tC

Sorry, we couldn't get FASTA sequence information for '1b3tC'. Either the entity '1b3tC' does not exist in this version of CATH or it does not pass the SIFT criteria for entry in the database.

[top]
Chain: 1b3tD

Sorry, we couldn't get FASTA sequence information for '1b3tD'. Either the entity '1b3tD' does not exist in this version of CATH or it does not pass the SIFT criteria for entry in the database.