PDB: 1aay XML data for PDB: 1aay

Molscript image for 1aay
1aay
PDB coordinates for PDB 1aay

PDB 1aay

CATH Domains (3)

Domain IDChain IDCATH codeImage
1aayA01 1aayA 3.30.160.60 Molscript image for 1aayA01
1aayA02 1aayA 3.30.160.60 Molscript image for 1aayA02
1aayA03 1aayA 3.30.160.60 Molscript image for 1aayA03

[top]
Chain: 1aayA

Chopping figure for chain 1aayA

[top]
Chain: 1aayB

Sorry the PDB chain 1aayB has been rejected from CATH as it does not pass the SIFT criteria.


[top]
Chain: 1aayC

Sorry the PDB chain 1aayC has been rejected from CATH as it does not pass the SIFT criteria.


[top]
Chain: 1aayA 

>pdb|1aayA
MERPYACPVESCDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKR
HTKIHLRQKD
BLAST against CATH

[top]
Chain: 1aayB

Sorry, we couldn't get FASTA sequence information for '1aayB'. Either the entity '1aayB' does not exist in this version of CATH or it does not pass the SIFT criteria for entry in the database.

[top]
Chain: 1aayC

Sorry, we couldn't get FASTA sequence information for '1aayC'. Either the entity '1aayC' does not exist in this version of CATH or it does not pass the SIFT criteria for entry in the database.