CATH Domain: 3c5eA02 XML data for domain: 3c5eA02

Molscript image for 3c5eA02
3c5eA02
PDB coordinates for domain 3c5eA02

PDB 3c5e, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.300 GMP Synthetase; Chain A, domain 3
3.30.300.30 Gene3D
3.30.300.30.2
3.30.300.30.2.1
3.30.300.30.2.1.1
3.30.300.30.2.1.1.1
3.30.300.30.2.1.1.1.1

[top]
Segment boundaries for domain 3c5eA02

Chopping figure for domain 3c5eA02
DomainStart PDB ResidueStop PDB Residue
3c5eA01 34 465
3c5eA02 466 569

Structural Neighbourhood (5 entries)

There are 5 matching structural neighberhood comparisons for CATH ID 3.30.300.30.2.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 5 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1t5hX04 90.77 4-chlorobenzoyl CoA ligaseAlcaligenes sp. AL3007 3.30.300.30 101 30 94 1.92 2.04
1mdbA04 90.65 2,3-dihydroxybenzoate-AMP ligase [EC:2.7.7.58]Bacillus subtilis2,3-dihydroxybenzoate-AMP ligaseBiosynthesis of siderophore group nonribosomal peptides 3.30.300.30 107 32 90 1.52 1.68
1lciA04 89.75 Photinus pyralisLuciferin 4-monooxygenasePeroxisome 3.30.300.30 99 29 91 2.10 2.30
1pg4A02 89.14 Salmonella enterica subsp. enterica serovar TyphimuriumAcetyl-CoA synthetase [EC:6.2.1.1]Glycolysis / GluconeogenesisPyruvate metabolismAcetyl-coenzyme A synthetase 3.30.300.30 120 32 84 1.49 1.77
1amuA04 86.71 Aneurinibacillus migulanusGramicidin S synthase 1 3.30.300.30 96 27 89 2.39 2.68
[1]
Displaying entries 1 to 5 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|3c5eA02
INSSGYRIGPSEVENALMEHPAVVETAVISSPDPVRGEVVKAFVVLASQFLSHDPEQLTKELQQHVKSVTAPYKYPRKIE
FVLNLPKTVTGKIQRAKLRDKEWK
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|3c5eA02
INSSGYRIGPSEVENALMEHPAVVETAVISSPDPVRGEVVKAFVVLASQFLSHDPEQLTKELQQHVKSVTAPYKYPRKIE
FVLNLPKTVTGKIQRAKLRDKEWKMSGKARAQ
BLAST against CATH

[top]
Domain History Events (6)

Domain assigned by auto on 17 Dec 2008 17:37

Assigning to "3.30.300.30" based on similarity with "2vzeA02"

Flow stage update by auto on 17 Dec 2008 17:14

No in_process hits for Domain "3c5eA02" ready to be processed

Flow stage update by auto on 17 Dec 2008 17:14

NW result present for Domain "3c5eA02"

Flow stage update by auto on 10 Dec 2008 14:16

All required files are present for Domain "3c5eA02"

Flow stage update by auto on 10 Dec 2008 14:14

Beginning processing for Domain "3c5eA02"

Insertion by cuff on 09 Dec 2008 12:26

nice chopping