CATH Domain: 3bf0C01 XML data for domain: 3bf0C01

Molscript image for 3bf0C01
3bf0C01
PDB coordinates for domain 3bf0C01

PDB 3bf0, Chain C, Domain 1

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.90 Alpha-Beta Complex
3.90.226 2-enoyl-CoA Hydratase; Chain A, domain 1
3.90.226.10 2-enoyl-CoA Hydratase; Chain A, domain 1 Gene3D
3.90.226.10.17
3.90.226.10.17.1
3.90.226.10.17.1.1
3.90.226.10.17.1.1.1
3.90.226.10.17.1.1.1.1

[top]
Segment boundaries for domain 3bf0C01

Chopping figure for domain 3bf0C01
DomainStart PDB ResidueStop PDB Residue
3bf0C01 56 178
3bf0C01 221 318
3bf0C02 189 220
3bf0C02 433 498
3bf0C03 319 432
3bf0C03 499 551

Structural Neighbourhood (0 entries)

Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.


[top]
Domain ATOM Sequence 

>pdb|3bf0C01
RGALLLDISGVIVDKPDRLQENSLFDIVNTIRQAKDDRNITGIVMDLKNFAGGDQPSMQYIGKALKEFRDSGKPVYAVGE
NYSQGQYYLASFANKIWLSPQGVVDSPAAREADSRWIGELWQNYLNTVAANRQIPAEQVFPGAQGLLEGLTKTGGDTAKY
ALENKLVDALASSAEIEKALTKEFGWSKTDKNYRAISYYDYAL
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|3bf0C01
RGALLLDISGVIVDKPDSSQRFSKLSRQLLGASSDRLQENSLFDIVNTIRQAKDDRNITGIVMDLKNFAGGDQPSMQYIG
KALKEFRDSGKPVYAVGENYSQGQYYLASFANKIWLSPQGVVDSPAAREADSRWIGELWQNYLNTVAANRQIPAEQVFPG
AQGLLEGLTKTGGDTAKYALENKLVDALASSAEIEKALTKEFGWSKTDKNYRAISYYDYAL
BLAST against CATH

[top]
Domain History Events (9)

Domain assigned by auto on 10 Mar 2009 16:13

Assigning to "3.90.226.10" based on similarity with "3bf0A01"

Flow stage update by auto on 10 Mar 2009 16:11

No in_process hits for Domain "3bf0C01" ready to be processed

Update comment by auto on 10 Mar 2009 16:06

Domain "3bf0C01" hits Domain "3bf0A01" (100% over 100%) which is currently in process

Update comment by auto on 21 Oct 2008 23:09

Domain "3bf0C01" hits Domain "3bezA01" (99.0950226244344% over 100%) which is currently in process

Flow stage update by auto on 21 Oct 2008 23:07

Domain "3bf0C01" hits Domain "3bezA01" (99.0950226244344% over 100%) which is currently in process

Flow stage update by auto on 21 Oct 2008 23:07

NW result present for Domain "3bf0C01"

Flow stage update by auto on 21 Oct 2008 08:34

All required files are present for Domain "3bf0C01"

Flow stage update by auto on 20 Oct 2008 18:49

Beginning processing for Domain "3bf0C01"

Insertion by auto on 20 Oct 2008 17:24

Final ChopClose added based on similarity with "3bf0A"